SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096MBZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096MBZ2
Domain Number 1 Region: 43-178
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 7.32e-44
Family Insert subdomain of RNA polymerase alpha subunit 0.0000252
Further Details:      
 
Domain Number 2 Region: 5-48,184-266
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 2.35e-31
Family RNA polymerase alpha subunit dimerisation domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096MBZ2
Sequence length 275
Comment (tr|A0A096MBZ2|A0A096MBZ2_POEFO) Polymerase (RNA) II (DNA directed) polypeptide C {ECO:0000313|Ensembl:ENSPFOP00000028933} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MPYANQPTVKITELTDENVKFVIENTDLAVANSLRRVFMSEVPTIAIDWIQIDANSSVLH
DEFIAHRVGLIPLTSDDIVDKMQYSRDCTCDDFCPECSVELTLDVRCTEDQTRHVTSRDL
LSNNPRVIPVTSRSRDNDPNDYVEQDDILLVKLRKGQELRLRAYAKKGFGKEHAKWNPTA
GVSFEYDPDNALRHTVYPRPEEWPKSEYSEIEEDEVQAPYDPNGKPERFYFNVESCGSLR
PETIVMSALAVLKKKLSDLQTQLSHEIQSDVLTIN
Download sequence
Identical sequences A0A096MBZ2 A0A147A554 M4ANH7
ENSXMAP00000016022 XP_005796323.1.87360 XP_007558553.1.10163 XP_008410005.1.1237 XP_012722978.1.37407 XP_014868717.1.96476 XP_014886872.1.100837 ENSXMAP00000016022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]