SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A096NT77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NT77
Domain Number 1 Region: 220-400
Classification Level Classification E-value
Superfamily MIR domain 8.76e-48
Family MIR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 1079-1170
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-18
Family SPRY domain 0.045
Further Details:      
 
Domain Number 3 Region: 3894-3972
Classification Level Classification E-value
Superfamily EF-hand 0.0000000138
Family Calmodulin-like 0.033
Further Details:      
 
Domain Number 4 Region: 659-806
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000301
Family SPRY domain 0.068
Further Details:      
 
Domain Number 5 Region: 1328-1455
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000313
Family SPRY domain 0.019
Further Details:      
 
Domain Number 6 Region: 433-549
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000000798
Family IP3 receptor type 1 binding core, domain 2 0.019
Further Details:      
 
Domain Number 7 Region: 2058-2123
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000157
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 
Domain Number 8 Region: 104-185
Classification Level Classification E-value
Superfamily MIR domain 0.0000103
Family MIR domain 0.021
Further Details:      
 
Domain Number 9 Region: 1803-1822,1891-1928,1958-2124,2415-2508,2552-2581
Classification Level Classification E-value
Superfamily ARM repeat 0.0000921
Family MIF4G domain-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096NT77
Sequence length 4859
Comment (tr|A0A096NT77|A0A096NT77_PAPAN) Ryanodine receptor 3 {ECO:0000313|Ensembl:ENSPANP00000016248} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=RYR3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MAEGGEGGEDEIQFLRTEDEVVLQCIATIHKEQRKFCLAAEGLGNRLCFLEPTSEAKYIP
PDLCVCNFVLEQSLSVRALQEMLANTGENGGEGAAQGGGHRTLLYGHAILLRHSFSGMYL
TCLTTSRSQTDKLAFDVGLREHATGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSER
YLHLSLSNGNIQVDASFMQTLWNVHPTCSGSSIEEGYLLGGHVVRLFHGHDECLTIPSTD
QNDSQHRRIFYEAGGAGTRARSLWRVEPLRISWSGSNIRWGQAFRLRHLTTGHYLALTED
QGLILQDRAKADTKSTAFSFRASKELKEKLDSSHKRDIEGMGVPEIKYGDSVCFVQHIAS
GLWVTYKAQDAKTSRLGPLKRKVILHQEGHMDDGLTLQRCQREESQAARIIRNTTALFSQ
FVSGNNRTAAPITLPIEEVLQTLQDLIAYFQPPEEEMRHEDKQNKLRSLKNRQNLFKEEG
MLALVLNCIDRLNIYNSVAHFAGIAREESGMAWKEILNLLYKLLAALIRGNRNNCAQFSN
NLDWLISKLDRLESSSGILEVLHCILTESPEALNLIAEGHIKSIISLLDKHGRNHKVLDI
LCSLCLCNGVAVRANQNLICDNLLPRRNLLLQTRLINDVTSIRPNIFLGVAEGSAQYKKW
YFELIIDQVDPFLTAEPTHLRVGWASSSGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLW
SGRIPRAVASINQHLLRSDDVVSCCLDLGVPSISFRINGQPVQGMFENFNTDGLFFPVMS
FSAGVKVRFLMGGRHGEFKFLPPSGYAPCYEALLPKEKMRLEPVKEYKRDADGVRDLLGT
TQFLSQASFIPCPIDTSQVVLPPHLEKIRDRLAENIHELWGMNKIELGWTFGKIRDDNKR
QHPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCHIAHVNPAAEEDLKKVKLPKNYMMS
NGYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLV
PYALLDERTKKSNRDSLREAVRTFVGYGYNIEPSDQELADSAVEKVSIDKIRFFRVERSY
AVRSGKWYFEFEVVTGGDMRVGWARPGCRPDVELGADDQAFVFEGSRGQRWHQGSGYFGR
TWQPGDVVGCMINLDDASMIFTLNGELLITNKGSELAFADYEIENGFVPICCLGLSQIGR
MNLGTDASTFKFYTMCGLQEGFEPFAVNMNRDVAMWFSKRLPTFVNVPKDHPHIEVMRID
GTMDSPPCLKVTHKTFGTQHSNADMIYCRLSMPVECHSSFSHSPCLDSEAFQKRKQMQEI
LSHTTTQCYYAIRIFAGQDPSCVWVGWVTPDYHLYSEKFDLNKNCTVTVTLGDERGRVHE
SVKRSNCYMVWGGDIVASSQRSNRSNVDLEIGCLVDLAMGMLSFSANGKELGTCYQVEPN
TKVFPAVFLQPTSTSLFQFELGKLKNAMPLSAAIFKSEEKNPVPQCPPRLDVQTIQPVLW
SRMPNSFLKVESERVSERHGWVVQCLEPLQMMALHIPEENRCVDILELCEQEDLMRFHYH
TLRLYSAVCALGNSRVAYALCSHVDLSQLFYAIDNKYLPGLLRAGFYDLLISIHLANAKE
RKLMMKNEYIIPITSTTRNIRLFPDESKRHGLPGVGLRTCLKPGFRFSTPCFVATGEEHQ
KQSPEIPLESLRTKALSMLTEAVQWSGAHIRDPVGGSVEFQFVPVLKLIGTLLVMGVFDD
DDVRQILLLIDPSVFGEHSAETEEGTEKEEVTQVEEKAVEAGEKAGKEAPVKGLLQTRLP
ESVKLQMCELLSYLCDCELQHRVEAIVAFGDIYVSKLQANQKFRYNELMQALNMSAALTA
RKTKEFRSPPQEQINMLLNFQLGENCPCPEEIREELYDFHEDLLLHCGVPLEEEEEEEED
TSWTGKLRALVYKIKGPPKPEKEQPTEEEERCPTTLKELISQTMICWAQEDQIQDAELVR
MMFNLLRRQYDSIGELLQALRKTYTISHASVSDTINLLAALGQIRSLLSVRMGKEEELLM
INGLGEIMNNKVFYQHPNLMRVLGMHETVMEVMVNVLSTEKSQIAFPKMVASCCRFLCYF
CRISRQNQKAMFEHLSYLLENSSVGLASPSMRGSTPLDVAASSVMDNNELALGLEEPDLE
KVVTYLAGCGLQSCPMLLAKGYPDVGWNPIEGERYLSFLRFAVFVNSESVEENASVVVKL
LIRRPECFGPALRGEGGNGLLAAMQGAIKISENPALDLPSQGYKREVTEADEEEEEIVHM
GNAIMSFYSALIDLLGRCAPEMHLIQTGKGEAIRIRSILRSLVPTEDLVGIISIPLKLPS
LNKDGSVSEPDMAANFCPDHKAPMVLFLDRVYGIKDQTFLLHLLEVGFLPDLRASASLDT
VSLSTTEAALALNRYICSAVLPLLTRCAPLFAGTDHCTSLIDSTLQTIYRLSKGRSLTKA
QRDTIEECLLAICNHLRPSMLQQLLRRLVFDVPQLNEYCKMPLKLLTNHYEQCWKYYCLP
SGWGSYGLAVEEELHLTEKLFWGIFDSLSHKKYDPDLFRMALPCLSAIAGALPPDYLDTR
ITATLEKQISVDADGNFDPKPINTVNFSLPEKLEYIVTKYAEHSHDKWACDKSQSGWKYG
ISLDENVKTHPLIRPFKTLTEKEKEIYRWPARESLKTMLAVGWTVERTKEGEALVQQREN
EKLRSVSQANQGNSYSPAPLDLSNVVLSRELQGMVEVVAENYHNIWAKKKKLELESKGGG
SHPLLVPYDTLTAKEKFKDREKAQDLFKFLQVNGVIVSRGMKDMELDASSMEKRFAYKFL
KKILKYVDSAQEFIAHLEAIVSSGKTEKSPHDQEIKFFAKVLLPLVDQYFTNHRLYFLSS
PLKPLSSSGYASHKEKEMVASLFCKLAALVRHRISLFGSDSTTMVSCLHILAQTLDTRTV
MKSGSELVKAGLRAFFENAAEDLEKTSENLKLGKFTHSRTQIKGVSQNINYTTVALLPIL
TSIFEHVAQHQFGMDLLLGDVQISCYHILCSLYSLGTGKNIYVERQRPALGECVASLAAA
IPVAFLEPTLNRYNPLSVFNTKTPRERSILGIPDTVEDMCPDIPQLEGLMKEINDLAESG
ARYTEMPHVIEVILPMLCNYLSYWWERGPENLPPSTGQCCTKVTSEHLSLILGNILKIIN
NNLGIDEASWMKRIAVYAQPIISKARPDLLRSHFIPTLEKLKKKAVKTVQEEEQLRADGK
GDTQEAELLILDEFAVLCRDLYAFYPMLIRYVDNNRSNWLKSPDADSDQLFRMVAEVFIL
WCKSHNFKREEQNFVIQNEINNLAFLTGDSKSKMSKSGGQDQERKKTKRRGDLYSIQTSL
IVAALKKMLPIGLNMCTPGDQELISLAKSRYGHRDTDEEVREHLRNNLHLQEKSDDPAVK
WQLNLYKDVLKSEEPFNPEKTVERVQRISAAVFHLEQVEQPLRSKKAVWHKLLSKQRKRA
VVACFRMAPLYNLPRHKINNFFLSTFQQVWLEKVNEKTQYDRLIPILMKSPKVEEEEEEE
TKKQPDPLHQIILYFSRNALTERSKLEDDPLYTSYSSMMAKSCQSGEDEEEDEDKEKTFE
EKEMEKQKTLYQQARLHERGAAEMVLQMISASKGEMSPMVVETLKLGIAILNGGNAGVQQ
KMLDYLKEKKDAGFFQSLSGLMQSCSVLDLNAFERQNKAEGLGMVTEEGTREKVLQNDEF
TRDLFRFLQLLCEGHNSDFQNFLRTQMGNTTTVNVIISTVDYLLRLQESISDFYWYYSGK
DIIDESGQHNFSKALAVTKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVVGFLHVFANMQ
MKLSQDSSQIELLKELLDLLQDMVVMLLSLLEGNVVNGTIGKQMVDTLVESSTNVEMILK
FFDMFLKLKDLTSSDTFKEYDPDGKGIISKREFQKAMEGQKQYTQSEIDFLLSCAEADEN
DMFNYIDFVDRFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKCLLDPAESVLNYFEPYLGR
IEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEKMELFVNFCED
TIFEMQLASQISESDSADRPEEEEEDEDSSYVLEIAGEEEEDGSFEPASAFAMACASVKR
NVADFLKRATLKNLRKQYRNVKKMTAKELVKVLCSFFWMLFLGLFQMLFTILGGIFQILW
STVFGGGLVEGAKNIRVTKILGDMPDPTQFGIHDDTMEAERAEVMEPGITTELVHFIKGE
KGDTDIMSDLFGLHPKKEGSLKHGPEVGLGDLSEIIGKDEPPTLESTVQKKRKAQAAEMK
AANEAEGKVESEKADMEDGEKEDKDKEEEQAEHLWTEVTKKKKRRCGQKAEKPEAFTANF
FKGLDIYQTKLLHYLARNFYNLRFLALFVAFAINFILLFYKVTEEPLEEETEDVANLWNS
FNDEEEEEAMVFFVLQESTGYMAPTLRALAIIHTIISLVCVVGYYCLKVPLVVFKREKEI
ARKLEFDGLYITEQPSEDDIKGQWDRLVINTPSFPNNYWDKFVKRKVINKYGDLYGAERI
AELLGLDKNALDFSPVEETKAEAASLVSWLSSIDMKYHIWKLGVVFTDNSFLYLAWYTTM
SVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNF
FRKFYNKSEDDDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDPYEMYRIVFDI
TFFFFVIVILLAIIQGLIIDAFGELRDQQEQVREDMETKCFICGIGNDYFDTTPHGFETH
TLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLG
Download sequence
Identical sequences A0A096NT77

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]