SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A096PCG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096PCG7
Domain Number 1 Region: 374-391,419-490
Classification Level Classification E-value
Superfamily RING/U-box 4.57e-22
Family Zf-UBP 0.067
Further Details:      
 
Weak hits

Sequence:  A0A096PCG7
Domain Number - Region: 522-616
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0392
Family Capz alpha-1 subunit 0.0095
Further Details:      
 
Domain Number - Region: 228-303
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0404
Family Canonical RBD 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096PCG7
Sequence length 704
Comment (tr|A0A096PCG7|A0A096PCG7_FUSPS) WGS project CBME000000000 data, contig CS3487_c000637 {ECO:0000313|EMBL:CEG02747.1} OX=1318458 OS=Fusarium pseudograminearum CS3487. GN=BN848_0039600 OC=Fusarium.
Sequence
MPSYFYHIKFELYPTPDPLTASSETEDRKDIWLPPPESSVFDDFPSHPRPDRQTTYRIPN
TPDSPSYNSANHTSPYTTVGKNSSTSSLGIIDCGTAARPPVKEAERKIEIVSERQWLERA
NSFPPPNSSAAIHPQNAVRDWRFGRVILETVDLRTGHTMAGDGSRNTPSAAPSLGPMFGG
AGTATKADLLPLETKNTELGWGVVHFYREGDETPSLVETEGQENGTGDSKSNDCTTLCIP
AVPAYMSPGDLMGFVGEKWRGDISHCRMVMTSRMNRYLVLLKFRDNMRAKQWRREFDGKV
FNTMEPQLCHVVFVKNITFETPTRRKSSAALSPLSSSAGMSSSLRPFPPPTPNLVELPTC
PVCLERMDETNGLMTIPCSHVFHCTCLQNWKGAGCPVCRFTNTSPDANSDPSNPHPQPFG
SGASNLCTICGCTDDLWICLICGYVGCGRYKGGHAKDHWKETAHCFSLELETQHVWDYAG
DMWVHRLIRAKGDGKVVELPSRNRSIGHLEEEDVVPRAKLESIGLEYTHLVTSQLESQRA
YYEELISKTVDKASKASATAENAIVQASKAMEKLALLDEKYTTLSEETIPELERQLERER
NKSNKSETLARNLGKSLQEEKRLNEGLMKRIEHLNNDHEAMAMKLEKVKAENADLQEMNR
DLSMFISGQEKLKELENEGKIAEGELEGGSASVPEKKSRRRAKR
Download sequence
Identical sequences A0A096PB76 A0A096PCG7 K3VBX9
XP_009261438.1.42154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]