SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096ZV70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096ZV70
Domain Number 1 Region: 2-66
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 5.13e-26
Family MHC antigen-recognition domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096ZV70
Sequence length 66
Comment (tr|A0A096ZV70|A0A096ZV70_POERE) MHC class II antigen beta chain {ECO:0000313|EMBL:AIS34789.1} OX=8081 OS=Poecilia reticulata (Guppy) (Acanthophacelus reticulatus). GN= OC=Poeciliinae; Poecilia.
Sequence
LKDIQYVLSMYYNKLEVARFDSNVDKYVGYTEFGVKQAEYFNNNPSEIARRRAQRETYCQ
HNIDIW
Download sequence
Identical sequences A0A096ZV70

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]