SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096ZVH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096ZVH0
Domain Number 1 Region: 2-65
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.82e-27
Family MHC antigen-recognition domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096ZVH0
Sequence length 66
Comment (tr|A0A096ZVH0|A0A096ZVH0_POERE) MHC class II antigen beta chain {ECO:0000313|EMBL:AIS34889.1} OX=8081 OS=Poecilia reticulata (Guppy) (Acanthophacelus reticulatus). GN= OC=Poeciliinae; Poecilia.
Sequence
LKDIQYINSYYYNKLEWARFDSNLGKFVGYTKFGVKNAERWNNDPSFIAGRKAERERYCQ
HNIGID
Download sequence
Identical sequences A0A096ZVH0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]