SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A097CK43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A097CK43
Domain Number 1 Region: 2-168
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 5.66e-56
Family MHC antigen-recognition domain 0.0000133
Further Details:      
 
Domain Number 2 Region: 174-243
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000259
Family C1 set domains (antibody constant domain-like) 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A097CK43
Sequence length 243
Comment (tr|A0A097CK43|A0A097CK43_9SYLV) MHC class I antigen {ECO:0000313|EMBL:AIS82582.1} OX=52609 OS=Acrocephalus schoenobaenus (sedge warbler). GN=Acsc-UA OC=Acrocephalinae; Acrocephalus.
Sequence
VGVSDPSSGIPQYMEMGFVDGIPFTRYDSERGREEPLTPWIKDSADPGYWDRNTQRAVQN
QHVFARNLETLRERYNQSGGLHTVLNVYGCELLSDGSVRGTDRVGYDGRDFISFELGSRR
FVPADSAAEITRRLWEGTEADYLTNYLKHDCPDWLQKYVGYGQKELERKEPPDVHVSGKE
EHGTLILSCRAYGFYPKTIAVNWMKGDEIWDQETEWGGVVPNSDGTFHTWARIEALPEER
EQY
Download sequence
Identical sequences A0A097CK43

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]