SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A097DEJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A097DEJ7
Domain Number 1 Region: 46-196
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 4.84e-54
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.00015
Further Details:      
 
Domain Number 2 Region: 201-281
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.45e-31
Family BC N-terminal domain-like 0.00011
Further Details:      
 
Domain Number 3 Region: 2-51
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 0.00000000000000494
Family BC ATP-binding domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A097DEJ7
Sequence length 282
Comment (tr|A0A097DEJ7|A0A097DEJ7_KRILY) Carbamoylphosphate synthase domain protein {ECO:0000313|EMBL:AIS93711.1} OX=320265 OS=Kricogonia lyside (Lyside sulphur butterfly). GN=CAD OC=Papilionoidea; Pieridae; Coliadinae; Kricogonia.
Sequence
SLDYCVVKVPRWDLAKFNRVSTKIGSSMKSVGEVMAIGRSFEEAFQKALRMVDENVNGFD
PYITEVNDNDLREPTDKRMFILAAALKAGYSVQKLYELTKIDPWFLNKLKNIIDYYGVLE
SINGGISMEFLKKAKKIGFSDKQIAAAIKSTELAVRKLREEYKITPFVKKIDTVAAEWPA
STNYLYLTYNGCTHDLEFPGEFIMVLGSGVYRIGSSVEFDWCAVGCLRELRNQKKKTIMV
NYNPETVSTDYDMSDRLYFEEISFEVVMDIYNIEHPDGVILC
Download sequence
Identical sequences A0A097DEJ7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]