SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A097J834 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A097J834
Domain Number 1 Region: 7-334
Classification Level Classification E-value
Superfamily Baseplate structural protein gp8 1.54e-153
Family Baseplate structural protein gp8 0.00000000000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A097J834
Sequence length 334
Comment (tr|A0A097J834|A0A097J834_BPT4) Baseplate wedge subunit {ECO:0000313|EMBL:AIT75338.1} KW=Complete proteome OX=697290 OS=Enterobacteria phage RB59. GN=RB59_154 OC=Tevenvirinae; T4virus.
Sequence
MNDSSVIYRAIVTSKFRTEKMLNFYNSIGSGPDKNTIFITFGRSEPWSSNENEVGFAPPY
PTDSVLGVTDMWTHMMGTVKVLPSMLDAVIPRRDWGDTRYPDPYTFRINDIVVCNSAPYN
ATESGAGWLVYRCLDVPDTGMCSIASLTDKDECLKLGGKWTPSARSMTPPEGRGDAEGTI
EPGDGYVWEYLFEIPPDVSINRCTNEYIVVPWPEELKEDPTRWGYEDNLTWQQDDFGLIY
RVKANTIRFKAYLDSVYFPEAALPGNKGFRQISIITNPLEAKAHPNDPNVKAEKDYYDPE
DLMRHSGEMIYMENRPPIIMAMDQTEEINILFTF
Download sequence
Identical sequences A0A097J7C6 A0A097J834 A0A0M7Q962 A0A0M7QB30 A0A0M7QBQ0 A0A0M7QFS3 D9IEI7 P19062
NP_049766.1.34590 WP_015969314.1.100868 YP_009180656.1.17673 YP_009197300.1.55766 1n7zA 1n7z_A 1n7z_B 1n7z_C 1n7z_D 1n80_A 1n80_B 1n80_C 1n80_D 1n8b_A 1n8b_B 1n8b_C 1n8b_D 1pdm_A 1pdm_B 1pdm_C 1pdm_D 1pdm_E 1pdm_F 1pdm_G 1pdm_H 1pdm_I 1pdm_J 1pdm_K 1pdm_L 1tja_A 1tja_B 5hx2_B 5hx2_C 5iv5_CA 5iv5_CB 5iv5_D 5iv5_E 5iv5_ED 5iv5_EE 5iv5_GG 5iv5_GH 5iv5_a 5iv5_b 5iv5_x 5iv5_y 5iv7_AA 5iv7_CB 5iv7_CC 5iv7_D 5iv7_E 5iv7_ED 5iv7_EE 5iv7_T 5iv7_U 5iv7_j 5iv7_k 5iv7_z 001780569|e5hx2B1|3899.1.1.1|B:1-334 D9IEI7_BPT4 VG08_BPT4 gi|9632688|ref|NP_049766.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]