SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A097NYX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A097NYX5
Domain Number 1 Region: 1-193
Classification Level Classification E-value
Superfamily ITPase-like 2.46e-66
Family ITPase (Ham1) 0.00000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A097NYX5
Sequence length 194
Comment (tr|A0A097NYX5|A0A097NYX5_9GAMM) Nucleoside-triphosphate pyrophosphatase {ECO:0000256|HAMAP-Rule:MF_01405} KW=Complete proteome OX=45071 OS=Legionella parisiensis. GN=lpari_03141 OC=Legionellaceae; Legionella.
Sequence
MKQIILATSNSGKISELRDLLSPIECIAQTNLGITDAVEDGLSFIENALIKARHASLYAE
KPALADDSGLVVPALNGEPGIYSARYAGNNATDAENIHLLLEKMAHVPSTQREAWFYCAI
ALVQHAKDPMPIIATGRCKGIIHTLPVGEGGFGYDPIFYIPDFQCTVAQLPAKIKNNISH
RAQALKQLRDIIKN
Download sequence
Identical sequences A0A097NYX5
WP_058516312.1.11507 WP_058516312.1.95379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]