SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A097P7A6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A097P7A6
Domain Number 1 Region: 215-390
Classification Level Classification E-value
Superfamily MIR domain 4.71e-40
Family MIR domain 0.0023
Further Details:      
 
Domain Number 2 Region: 1079-1207
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-23
Family SPRY domain 0.025
Further Details:      
 
Domain Number 3 Region: 659-793
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000293
Family SPRY domain 0.044
Further Details:      
 
Domain Number 4 Region: 4185-4244
Classification Level Classification E-value
Superfamily EF-hand 0.00000000342
Family Calmodulin-like 0.078
Further Details:      
 
Domain Number 5 Region: 98-182
Classification Level Classification E-value
Superfamily MIR domain 0.000000196
Family MIR domain 0.024
Further Details:      
 
Domain Number 6 Region: 1542-1666
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000194
Family SPRY domain 0.047
Further Details:      
 
Domain Number 7 Region: 2257-2342
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000157
Family IP3 receptor type 1 binding core, domain 2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A097P7A6
Sequence length 5094
Comment (tr|A0A097P7A6|A0A097P7A6_TRICA) Ryanodine receptor RyR {ECO:0000313|EMBL:AIU40166.1} OX=7070 OS=Tribolium castaneum (Red flour beetle). GN= OC=Cucujiformia; Tenebrionidae; Tenebrionidae incertae sedis; Tribolium.
Sequence
MAEAEGGSEQDDVSFLRTEDMVCLSCTATGERVCLAAEGFGNRHCFLENIADKNIPPDLS
QCVFVIEQALSVRALQELVTAAGNETGKGTGSGHRTLLYGNAILLRHQNSDMYLACLSTS
SSNDKLAFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLHTTKE
NEISIVNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSTWSIDAN
IVIYEGGSVMSQARSLWRLELARTKWAGGFINWSHPMRIRHITTGRYLAVNENNELYLVS
REEANTATTAFCLRQEKDDQKVVLEDKDLEVIGSPIIKYGDSTVIVQHSETGLWLSYKSY
ETKKKGVGKVEEKQAILHEEGKMDDGLDFSRSQEEESRTARVIRKCSSLFTQFINGLETL
QMNRRHSVFFLAVNLNEMVMCLEDLINYFAQPEDDMEHEEKQNRFRALRNRQDLFQEEGI
LNLILEAIDKINVITSQGFLAGLAGDQNWEMISGYLYQLLAAIIKGNHTNCAQFANSNRL
NWLFSRLGSQASSEGTGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEKHGRDPKVLDV
LCSLCVGNGVAVRSSQNNICDYLLPGKNLLLQTQLVDHVASVRPNIFVGRVDGSAIYQKW
YFEVTVDHIEQTTHMMPHLRIGWANSKGYVPYPGGGEKWGGNGVGDDLYSYGFDGVYLWS
GGRSTQVVTTYTTPFIKKNDVVGCALDLTVPIITFTFNGVPIKGSFRNFNLDGMFFPVIS
CSSKLSCRFLLGGDHGRLKYIPPEEFSPLVESLLPQQILNLEPCFYFGNMNKNVIAGPLT
VEDDTAFVPNPVDTSMVSLASYVESIRDKLAENIHEMWAMNKIEAGWQWGEYRDDLRHIH
PCLVPFDKLPPAEKKYDSQLAVQTLKTIIALGYHITMDKPPSRIKTVRLPNEPFMQSNGY
KPAPLDLSAITLTPKLEELVDQLAENTHNLWAKERIQQGWTYGLNEDPDMFRSPHLVPYI
KVDDAIKKANRDTASETVRTLLVYGYNLDPPTGEQHEALLAEASRSRQAIFRTYRAEKNY
AVSSGKWYFEFEILTAGPMRVGWAKADCAPGCMLGSDENTWAFDGYNEEKVYSNSAESFG
KQWQVGDVVGVFLDLIDHTISFSLNGELLMDALGGETTFADVQGDNFVPAFTLGVGQKAR
LCFGQDVTQLKYFTMCGLQEGYEPFCVNMKRPVTYWYTKDQPIFENTDDMPDTKIDVTRI
LAGSDSPPCLKISHNTFETMEKANWEFLRLSLPVICHSTFISEDEKMRRWQEIKIRQHRL
KAEAESNISPAHIEQMMMKSGFSMSDIKGLHRNYSEDAVESDEVMKHHGKSTKSMPARPP
RKGSLSRNVNGFEDNMLGANTGRGVNRSTSELNLNRYLDMAPANQEKPDEKKKRGRSPFR
FFSRKKAGNSPGGESVKADKSKTPDRERERMGTIKVPTRQAGVSPSRLTRSPTIKQSQSD
LMQVPAAASGQQKQLSVPHTSDVEAVGDELFDGECLKLINEYFYGVRIFPGQDPTHVYVG
WVTTQYHRHTKDFNQNQVRKSSIVILDDYDRVVDCVDRQSCYMVRADELYNQVTQDASGK
GASQGMFIGCFLDAATGVITFTCEGKPTSHVFRMEPETKLFPAIFVEATSKEILQIELGR
TPTSLPLSAAVLQNSAKHVIPQFPPRLKVQCLKPHQWARVPNQSLQVHALKLSDIRGWSM
LCEDAISMLALHIPEEDRCIDVLELIEMDKLLSFHAHTLTLYAALCYQSNYKAAHVLCKH
VNQRQLLYAIKAEYMSGPLRQGFYDLLIAVHIESAATTMEVCQNEYVIPLSQELKEMYED
PEMRHSLRALMMESVQPQMKMSDITDTVENIKNLYSPYFPLDIVRDYVMTALAEAVETNQ
VHNRDPIGGSNENLFLPLLKLVDRLLLVGMLRDEDIAKLLIMICPETWDPSFVKDGKDEH
RKGLLSMKMAEGAKLQMCYLLQHLCDIQLRHRVESIIAFSHDFVGDLQSDQLRRYIEIKQ
SDLPSAVAAKKTREFRCPPREQMNAILSFKNLEEEDKENCPLGEELCEKLNDFHGLLMSH
VSLQALQAPEEEEGNDVQKPGPFKRLYNFINAVKELEEEPKEEPEPEKKTPEEIFRKVLI
STIVQWAEEAQIETPKLVQEMFSLLVRQYDSVGELIRALQKTYVINAKTKQDVAEMWVGL
SKIRALLPVQMSQEEEELMRERLWKLVNNHTFFQHPDLIRVLRIHENVMAVMINTLGRRS
QAQSDAQAQAQAAEGDTTVKEKDTSHEMVVACCRFLCYFCRTGRQNQKAMFEHFDFLLEN
SNILLARPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAIYLSRCGLQSNSELVEKG
YPDLGWDPVEGERYLDFLRFCVWVNGESVEENANLVIRLLIRRPECLGPALRGEGEGLLR
AIVDANKMSERISDRRKMMDEAEGTVNVAPFTHPLPESDDDEDYIDTGAAILNFYCTLVD
LLGRCAPDATVIELGKNESLRARAILRSLVPLEDLQGVLSLRFTLQNPAAGEERPKSDMP
SGLIPGHKQSVVLFLERVYGIETQELFFRLLEEAFLPDLRCATMLDRNDGSESDMALSMN
RYIGNSILPLLIQHSKFYSEAENYASLLDATLHTVYRLSKNRMLTKGQREAVSDFLVALT
SALQPSMLLKLLRKLTVDVSNLSEYTTVALRLLTLHYDRCAKYYGSSTGQGLYGAASDEE
KRLTMMLFSNIFDSLSKMDYDPELFGKALPCLSAIGCALPPDYSLSKNYDDEWYANKSAK
TGPDGPYNPQPINTSSVALNNDLNSIVQQFSEHYHDAWASRKLENGWQYGETWSDSNKTH
PRLKPYSMLNDYEKERYKEPVRESLKALLAIGWSVEHSEVDHPSTNRNSVHHQSGEGSSP
FNYNPHPVDMTNLTLSREMQNMAERLAENAHDIWAKKKKEELNTCGGGIHPQLVPYDLLT
DKEKRKDRERSQEFLKYLQYQGYKLHKPIRGGQGETEQTTAGASIELRFAYSLLEKLIQY
ADRATINMKLLKPSSTFSRRPSYKTSSRDIKFFSKVVLPLMEKYFSTHRNYFIAIATATN
NVGAASLKEKEMVASLFCKLASLLRSKLTAFGADVRITVRCLQVLVKGIDAKSLVKNCPE
FIRTSMLTFFNNTADDLGHTIINLQEGKYSHLRGTHLKTSTSLFYVNTVIIPILTAMFDH
LANCEYGSDLLLDEIQVASYKILQALYTLGTDTTLTHDRKYLKTEIEKYKPALGSCLGAF
SSTFPVAFLEPHLNKNNQFSFLNRIADHSLEAQDIMAKMEGSMPTLETILSEVDQFVESE
KTYSDAPHIIDVIMPMLCSYLPFWWSQGPDNVSPTGGTHVSMVTAEHMNHLLKNVLKLIK
KNIGNETAPWMTRIAAYTQQIIINSSEELLRDPFLPLAERVKKRTETMFHKEESLRGFIK
SSSDDTSQIETQIQEDWHLLVRDIYAFYPLLIKYVDLQRNHWLRHNIAEAEDLYNHVADI
FNIWSKSQYFLREEQNFISANEIDNMVLIMPTATRRPVVTDGTQQTGGKKKKKHRDKKRD
KDKEIQASLMVACLKRLLPVGLNLFAGREQEMVQHCKDRFLKKAPEYDIIEFAKTQLTLP
DKIDPADEMSWQHYLYSQLGSKKSAAVGMVDNNGKNLLEETVDRIVAMSKVLYGLHMIDH
PQQQQKGVYHSVVSTQRKRAVLSCFRQASLHSLPRHRAINIFIRSYYELWLQDENVGQEV
MIEDLTQSFEDSELKKKDGEEEESKPDPLTQLVTTFCRGAMTERSGALQEDPLYMSYAEI
IAKSCGEEEEEGEEEESGEGEEGGASIHEQEMEKQKLLFNQARLAKRGVAEMVLLHISAC
KGVPSEMVMKTLELGISILRGGNFDIQMGMLNHLKEKKDVGFFTSIAGLMNSCSVLDLDA
FERNTKAEGLGVGSEGAAGEKNMHDAEFTCALFRFIQLTCEGHNLEWQNYLRTQAGNTTT
VNVVICTVDYLLRLQESIMDFYWHYSSKDLIDPAGKANFFKAIGVASQVFNTLTEVIQGP
CTLNQQALAHSRLWDAVGGFLFLFSHMQDKLSKHSSQVDLLKELLNLQKDMITMMLSMLE
GNVVNGTIGKQMVDTLVESASNVELILKYFDMFLKLKDLTSSPSFQEIDINNDGWVSPKD
FKEKMEQQKSYTSEEIDFLLACCEVNHDGKVDYIGFIDRFHEPAKEIGFNLAVLLTNLSE
HMPNEPRLARFLETAGSVLNYFEPFLGRIEILGGSKRIERVYFEIKESNIEQWEKPQIEE
SKRAFFYSIVTEGGDKEKLEAFINFCEDAIFEMQHASGLMAVEESGGGGPTRAASYSYMN
VDDEDRGKDPIRRGYQSIKEGIAYGLSSLSPSNIKHKFAEMQQMTIPELFIGFFRMIIYA
FYYSGFGVAIIFKYIFGVLLSLMRGPIEEPAVLEIKEEEEKVGLSRVLPALPSSEEQNTQ
MQAFGLDITKEDNGQYKMAAHESPTTSQPSSAEGEGETTPEEDGEHPETETMEAPLSLSD
LLGGEQAKRAAQEKVEAQAAQQAVMQAIESESKQPVVTEPSAVSQINFGAYSHRAVSFLA
RNFYNLKYVALVLAFCINFMLLFYRVSTLGDDAEGSGSKGIPDILEGSAEGSGAGSGESG
EDDDPPELVHVDEDFYYMAHVMRLAAILHSVVSLAMLIAYYNLKVPLAIFKREKEIARRL
EFEGLYIAEQPEDGDLKSHWDKLVISAKSFPVNYWDKFIKKKVRQKYSETYDFDSISNLL
GMEKTSFQQQESDEGRSFIYFIINIDWRYQIWKSGVAITDNSFLYSLWYFIFSILGNFNN
FFFAAHLLDVAVGFKTLRTILQSVTHNGNQLVLTVMLLTIVVYIYTVIAFNFFRKFYVQE
EDEEVDKKCHDMLTCFVFHLYKGVRAGGGIGDEIEPPDGDDYEVYRIMFDITFFFFVIVI
LLAIIQGLIIDAFGELRDQLESVKEDMESNCFICGMGKEYFDKVPHGFDTHVQQEHNLAN
YMFFLMHLINKPDTEYTGQETYVWNMYQQRCWDFFPVGDCFRKQYEEELGGGGG
Download sequence
Identical sequences A0A097P7A6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]