SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A097P7A8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A097P7A8
Domain Number 1 Region: 239-426
Classification Level Classification E-value
Superfamily MIR domain 5.93e-58
Family MIR domain 0.000000169
Further Details:      
 
Domain Number 2 Region: 427-596
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.44e-52
Family IP3 receptor type 1 binding core, domain 2 0.000000363
Further Details:      
 
Domain Number 3 Region: 1128-1156,1190-1302
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 9.81e-40
Family IP3 receptor type 1 binding core, domain 2 0.0038
Further Details:      
 
Domain Number 4 Region: 109-222
Classification Level Classification E-value
Superfamily MIR domain 0.00000000000000144
Family MIR domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A097P7A8
Sequence length 2724
Comment (tr|A0A097P7A8|A0A097P7A8_TRICA) Inositol 1,4,5-trisphosphate receptor IP3R {ECO:0000313|EMBL:AIU40167.1} OX=7070 OS=Tribolium castaneum (Red flour beetle). GN= OC=Cucujiformia; Tenebrionidae; Tenebrionidae incertae sedis; Tribolium.
Sequence
MNEMGSSSLLHLGDIVSLYAEGTVSGFLSTLGLVDDRSVVCPEAGDLSNPPKKFRDCLFK
ICPMNRYSAQKQFWKAAKQSMSSNTDTNLLKRLHHAAEIEKKQNDTENKKLLGTNVQYGS
VVQLLHLKSNKYLTVNKRLPALLEKNAMRVYLDGNGNEGSWFYILPFYKLRATGDNIVLG
DKVILNPVNAGQQVLHVAANHELPDNPGCKEVNVVNGSTSWKVTLFMEHRENSDEILKGG
DVVRLFHAEQEKFLTMDEYKRTHHVFLRTTGRTSATAATSSKALWEVEVVQHDPCRGGAG
HWDSLFRFKHLATGQYLAADVDNDQATDQMRSKLRADSADQTVYHLVPVAYPNEIASLFE
LDPTSLTRGDSLVPQSSYVRLHHLFTNSWVHSTSIPIDKDEEKPVMSKVGCAVMKEDKEA
FALISVSPVEVRDLDFANDACKLLSSLSVKLEKGTISHNERRSLTTLLQDIVYFVAELEN
EQNKTEALELVVTNPNRDRQKLLREQAILKQLFKILQGPFLDNNGDGPFLKIEELNDPRH
ASYKYIFRLCYRILRLSQQDYRKNQEYIAKHFGFMQKQIGYDILAEDTITALLHNNRKLL
EKHITPAEIETFVGLVRKNMSNWESRFLDYLSDLCISNKKAIPVTQELICKSVLSQKNSD
ILIETRMMKTQVEVQEVSEEHPLESDDSELEQMVTVVEECQIILLWNNRQKSMSLSELCK
NAKLGSRDDQAILDYYRHQLDLFSNMCLNRQYLALNNLSPHLDIELILKCMADETVNFDL
RASFCRLMLHLHVDRDPQEPVTPVKYARLWSEIPSKMSIHDYDSNKTPDPNKEAVRARFC
STIAFVEDYLCNVVAKMWSFADQEQNKLTFEVVKLARELIYFGFYSFSDLLRLTKTLLSI
LDCVSENDFADGRLPTGDIDSGDSLLDERAEGGVLRSIGDMGAVMTSLALGPVGRSVVTT
NAGQHGKGSQYMKEYPLVMDTKLKIIEILQFILDVRLDYRISCLLSIFKQEFDESEKNNA
GDSLNLGQKNIDLELIGSQAEGIFGSSEECAVLDLDGHGGRTFLRVLLHLTMHDYPPLVS
GALHLLFRHFSQRQEVLQAFRQVQLLVSDSDVESYKQIKADLDVLRQSVEKSELWVYKSK
CIDEHNTTSSKKNKEEEEEVTTTKTPSLSVLEKKGSAINLDVGPPLHPEQADEYKKIQQI
LIRMNKLCTQGSPSGMVKPRKHEQRLLRNVGVHTVVLDLLQIPYDEKEDIRMNELMRLAH
EFLQNFCLGNQQNQVLLFKHLDLFLNPGIREAQTVCAIFQDNSTLCNEVNEKVIQHFVHC
IESHGRHVQYLKFLQTIVKAENQFIRKSQDMVMQELINAGEDVLVFYNDKASFNHFIEMM
RSERHCMDEGSPLKYHVELVKLLACCTMGKNVYTEIKCHSLLPLDDIVAMVTHPDCIPEV
KEAYVGFLNHCYIDTEVEMKEIYTSNHMWTLFEKSFLVDMADIATAPTDRKHPDKALENY
VTNCVMNIISTFFSSPFSDQSTTVQTRQPIFVQLLQSAFRVSQCPWLSASQRFNVENCIR
TLSDVAKNRGIAIPLDLESQVAAMFNKATILTRQTSKWLQASKTPKMERSQSQLMRLDRS
IIEGLQDIVSLLEDQLKPLVQSELSLLVDVLYRPELLFPPGTESRKKCESGGFIRRLIKH
TETLLEEKKEKLCVKVLKTLREMMAIDPEYGEKGDVLRNSLLARYFGKAFVQKHDTVELG
SYQISSVMHGPGAKVLRRAGRTLHEVQTHLDREGASDLVVELVIKSVNSPSIFGEAVELG
IALLEGGNPIIQKSMFNKLLGGDLSQAFFRVFYDKMKGSQQEIKSTVSVNTSDIAAKAHE
DKQDGKDLDKVSKKQGGKSNGILISDELREELSRAAESTSQAYAQIRNMAVGEDGTVTSG
TASAFEDLLAEKLEKHRDREDQNSLSNKVLIMQPILRSLQLLCENHNPALQNLLRNQNNK
TNYNLVSETLMFLDCICGSTTGGLGLLGLYINENNVSLINQTLETLTEYCQGPCHENQNC
IATHESNGLDIITALILNDINPLGKSRMDLVLELKNNASKLLLAIMESRGDSENAERILY
NMNPKQLVDVACRAFHQETAEDDEEVDDGSVEDAVSPKEVGHNIYILCHQLAQHNKELAA
LLKPADFGSDPKTHKALIYYATHTAQIEIVRHDRTLEQIVFPIPEICEYITTDTKIKVFN
TAERDDQGSKVVDFFERTESMFNEMKWQKKLRAQPVLFWVSSYMSLWSNILFNCAVLINL
IVAFFYPFEDTLPKISSSISVLIWVAMLASTAIVVTLPRETGIRTLVASTILRLIFSLGP
EPTLWLLGTVTILLKGIHLVSIMGNHGTLTKTYQQILTDAELVYHLAYLVFCMLGLLMHP
FFYSVLLFDVVYREETLLNVIRSVTRNGRSIILTAVLALILVYMFSIIGYMFFKDDFIVS
VKKKTDETICETVSDTSGNKYTHDNAQYCKIVDPGEEKKERACDSLIMCIVTTLNQGLRN
GGGIGDILRAPSSEEALFVARVVYDLLFFFVVIIIVLNLIFGVIIDTFADLRSEKQQKEL
ILKNTCFICGLNRSAFDNKTVSFEEHIKCEHNMWHYLYFIVLTKVKDPTEFTGPESYVYA
MVKASNLDWFPRLRAMSLAAVEGEGEQIELRSLQAQLENTQVLVTNLSQQLMELKDQMAE
QRKQKQRIGLLNSASAYLQTPNLL
Download sequence
Identical sequences A0A097P7A8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]