SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A097SR27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A097SR27
Domain Number 1 Region: 9-109
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.0000863
Family Family 1 bi-partite nucleotidyltransferase subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A097SR27
Sequence length 145
Comment (tr|A0A097SR27|A0A097SR27_9BACT) Uncharacterized protein {ECO:0000313|EMBL:AIU93984.1} OX=77133 OS=uncultured bacterium. GN=ofn35 OC=Bacteria; environmental samples.
Sequence
MSENRLPDYLDHIQQAATDARSFVEGMARDDFLADKCTQQAVIMSLIVIGEAATKVMDGY
AEFTQAHADVPWRSMRNMRNRMAHGYFDINLDVVWETVQQWLPELLKQLPAVRLDANDPA
VKAYPHEEAMQVVQERIDRAKGKPC
Download sequence
Identical sequences A0A097SR27 Q4W1S2
gi|66968592|ref|YP_245469.1|NC_007100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]