SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A097SSH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A097SSH5
Domain Number 1 Region: 67-139
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 7.98e-20
Family Ribosomal protein L11, C-terminal domain 0.00044
Further Details:      
 
Domain Number 2 Region: 6-71
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 4.06e-18
Family Ribosomal L11/L12e N-terminal domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A097SSH5
Sequence length 156
Comment (tr|A0A097SSH5|A0A097SSH5_9MOLU) 50S ribosomal protein L11 {ECO:0000256|HAMAP-Rule:MF_00736, ECO:0000256|SAAS:SAAS00731162} KW=Complete proteome; Reference proteome OX=1318617 OS=Candidatus Mycoplasma girerdii. GN=MGM1_1470 OC=Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
Sequence
MAAKEKKITRIAKIQLIGGQAKPGPALASIGINMAEFTKQFNDLTRKDRNGDVVPCIITA
YQDKTFDFVIKSTPASVLLKRVAKIEKAGKNQLTDNVATISKEQALEIAKAKMADLNAYD
EEGALRMIAGTAKQMGIKIKDVDLTPRKTEKMKGAN
Download sequence
Identical sequences A0A097SSH5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]