SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A098BDX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098BDX0
Domain Number 1 Region: 153-265
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.00000000000000134
Family Duplicated SiR/NiR-like domains 1 and 3 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A098BDX0
Sequence length 274
Comment (tr|A0A098BDX0|A0A098BDX0_9NOCA) Precorrin-3B synthase {ECO:0000313|EMBL:CDZ86893.1} KW=Complete proteome OX=1830 OS=Rhodococcus ruber. GN=CSW53_00400 OC=Rhodococcus.
Sequence
MAPAHEPVDLVEVSLPGGRLAAAQLQILAELAHDHAGGALVLTADGLGLRGNRAELTAQL
SGHGFDLPGPHRRRLLASPLSGRIGGHVDVRDILAEVHRRLTALAPGRDLVVGIDDGSGD
IAALAPEVGAAALPDRRWALLLDGTDTGVRLPPDDVVETLVAAAQRPPRAGVAATLAALG
VEPSAPPARRPSAPARPVGWLDQPDGAVTLGGGLPGAVLPARTAEFLAAVDRPLVVTPWS
VVLLCDLDEWAAEQVVRVLAPMGLVFDADSPELR
Download sequence
Identical sequences A0A098BDX0
WP_010596437.1.25671 WP_010596437.1.28716 WP_010596437.1.61558 WP_010596437.1.83560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]