SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A098BMP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098BMP9
Domain Number 1 Region: 80-264
Classification Level Classification E-value
Superfamily Rhomboid-like 2.35e-39
Family Rhomboid-like 0.0029
Further Details:      
 
Domain Number 2 Region: 15-47
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000893
Family B-box zinc-binding domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A098BMP9
Sequence length 308
Comment (tr|A0A098BMP9|A0A098BMP9_9NOCA) Serine peptidase {ECO:0000313|EMBL:CDZ89978.1} KW=Complete proteome OX=1830 OS=Rhodococcus ruber. GN=CSW53_23020 OC=Rhodococcus.
Sequence
MTNPGWGHAAGGGGHPPQPRCVRHPDRPTLLSCSRCGRPACPDCLRSAAVGQQCVDCVGA
ARRDVPQARTVAGAPVRSQANTPLVTYILIALNTAIFAITAAQSGSVMNNERSSSLFFEW
ALWPPMIAARDEYIRVLGSGFLHFGVLHLAVNMFALYVIGRDTELVLGRLRYLAVYLVSI
LGGSAAVMLLETGAVTAGASGAVFGLLGAQAVILMRLRRSPAPVLAIVVLNVVISITIPG
ISLWGHLGGLAAGAAATAALLFAPRALGAGDDRARFVRTGWLALGGVTVVTVLVLALAVL
RLRAQLGV
Download sequence
Identical sequences A0A098BMP9
WP_040273131.1.20521 WP_040273131.1.25671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]