SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A098BZ82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098BZ82
Domain Number 1 Region: 3-123
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.16e-44
Family Ribosomal protein S13 0.0000217
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A098BZ82
Sequence length 126
Comment (tr|A0A098BZ82|A0A098BZ82_9PORP) 30S ribosomal protein S13 {ECO:0000256|HAMAP-Rule:MF_01315} KW=Complete proteome; Reference proteome OX=1562970 OS=Fermentimonas caenicola. GN=ING2E5B_0706 OC=Porphyromonadaceae; Fermentimonas.
Sequence
MAIRIVGVDLPQNKRGEVALTYIYGIGRSAANTILTKAEVDRDIKVKDWTDDQAARIREI
ISTEFKVEGDLRSEVQLNIKRLMDIGCYRGIRHRIGLPVRGQSTKNNARTRKGRKKTVAN
KKKATK
Download sequence
Identical sequences A0A098BZ82
WP_045089303.1.100843 WP_045089303.1.41605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]