SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A098ESB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098ESB5
Domain Number 1 Region: 50-171
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 5.89e-44
Family Insert subdomain of RNA polymerase alpha subunit 0.0000447
Further Details:      
 
Domain Number 2 Region: 5-54,146-230
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 6.67e-33
Family RNA polymerase alpha subunit dimerisation domain 0.0008
Further Details:      
 
Domain Number 3 Region: 247-313
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 7.85e-25
Family C-terminal domain of RNA polymerase alpha subunit 0.0000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A098ESB5
Sequence length 314
Comment (tr|A0A098ESB5|A0A098ESB5_9BACI) Transcriptase subunit alpha {ECO:0000256|HAMAP-Rule:MF_00059} KW=Complete proteome; Reference proteome OX=1476857 OS=Bacillus sp. B-jedd. GN=BN1002_00060 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MIEIEKPKIETVEISDDAKYGKFVVEPLERGYGTTLGNSLRRILLSSLPGAAVTSIQVDG
VLHEFSTIEGVVEDVTSIILNIKKIALKIYSDEEKTLEIDVQGEGGVKASDITHDSDVEI
LNPDLHIATLGSNGHLRMRLTARRGRGYTPADQNKREDQPIGVIPIDSIYTPVSRVSYQV
ENTRVGQMTNYDKLTLDVWTDGSTGPQEAIAFGAKILTEHLNIFVGLTDEAQNAEIMIEK
EEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELANKTEEDMMKVRNLGRKSLEEVK
AKLEELGLGLRKDD
Download sequence
Identical sequences A0A098ESB5
WP_048823031.1.70412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]