SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A098F6G9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098F6G9
Domain Number 1 Region: 3-182
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.05e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A098F6G9
Sequence length 183
Comment (tr|A0A098F6G9|A0A098F6G9_9BACI) Pyruvate/ketoisovalerate oxidoreductase {ECO:0000313|EMBL:CEG29761.1} KW=Complete proteome; Reference proteome OX=1476857 OS=Bacillus sp. B-jedd. GN=BN1002_04721 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MLEEIIIAGFGGQGVMSMGQLIAYAGLHEGKNVSWLPSYGPEQRGGTANCAVVVSDEPIG
SPLVSAPSAAIVLNIPSFEKFEPKVRAGGLLLTNSSLIGKKSQRTDLTAIEINATAMANE
LGNGKVANMILLGAFIKATGILSPESVLSSLQQVLSPDKHYLLEMNRLALNKGAEIVCEI
KVK
Download sequence
Identical sequences A0A098F6G9
WP_048828277.1.70412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]