SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A098L0U0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098L0U0
Domain Number 1 Region: 1-129
Classification Level Classification E-value
Superfamily FlgN-like 3.66e-22
Family FlgN-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A098L0U0
Sequence length 155
Comment (tr|A0A098L0U0|A0A098L0U0_GEOTH) Uncharacterized protein {ECO:0000313|EMBL:GAJ57430.1} KW=Complete proteome OX=1406857 OS=Geobacillus thermoleovorans B23. GN=B23_0619 OC=Geobacillus thermoleovorans group.
Sequence
MTFAALIHLLRAHIELHESLLALSRRKTEALKKNDIEALSALLTDEQKHILAIRQLEERR
RRWLKEVLGDETVTIAQCEAMAKGKEREELRECRERLKQAVNAVAEANELNRQLIEQSLQ
FVTAMIETFTPTPSTYSRTQGYAPSPDRPLFESKA
Download sequence
Identical sequences A0A098L0U0 A0A2H5KJ71 G8MXP4
gi|375010272|ref|YP_004983905.1| WP_014196773.1.60903 WP_014196773.1.78869 WP_014196773.1.8599 WP_014196773.1.90668 WP_014196773.1.91533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]