SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A098L6H4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098L6H4
Domain Number 1 Region: 197-458
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.53e-73
Family PFOR Pyr module 0.032
Further Details:      
 
Domain Number 2 Region: 1-221
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.23e-47
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0025
Further Details:      
 
Domain Number 3 Region: 470-580
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.06e-22
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A098L6H4
Sequence length 590
Comment (tr|A0A098L6H4|A0A098L6H4_GEOTH) 2-oxoglutarate synthase2-oxoglutarate-ferredoxin oxidoreductase alpha subunit {ECO:0000313|EMBL:GAJ59375.1} KW=Complete proteome OX=1406857 OS=Geobacillus thermoleovorans B23. GN=B23_2600 OC=Geobacillus thermoleovorans group.
Sequence
MIEQLSWKVGGQQGEGIESTGEIFSTALNRLGYYLYGYRHFSSRIKGGHTNNKIRVSTKP
VRAVADDLDILVAFDQETIDFNFHELRDGGIVIADAKFNPVIPEGKGVALYAVPFTDIAT
QLGNPLMKNMVAIGATSAVLDLDAAVFESVVVDTFGRKGAQVVEKNMEAIRAGAQYMKEQ
LDGSTKTMKLAKADGKRRMFMIGNDAIALGAIAGGARFMAAYPITPASEIMEYLIKKLPD
FGGAVIQTEDEIAACTMAIGANYAGVRAFTASAGPGLSLMAEAIGLAGMTETPLVVVDTQ
RGGPSTGLPTKQEQSDLLAMIYGTHGEIPKIVMAPSTVEEAFYDMAEAFNLAEEYQCPVI
FLSDLQLSLGKQTVEPLDYDRIEIRRGKLMNGELPPLPDKDNFKRYEITPDGVSPRVLPG
TKYGIHHVTGVEHAETGRPSETAANRRAQMEKRMRKLEHIHFPTPVHKQLRHEEPDLLLV
GFLSTRGAIEEAMERLEQDGVKVNHAHIRLLHPFPVDDVRPLVEKAKRVVVVEQNATGQL
ANLLKMNVGHADKIASVLKFDGNPFLPGDVYTKCKELLAQWPPLKISAMM
Download sequence
Identical sequences A0A063YVR3 A0A098L6H4 A0A1V9BZ77 A0A2H5KF47 G8N215 Q5L0F0 S4N9Y1
WP_011230800.1.19233 WP_011230800.1.2219 WP_011230800.1.45808 WP_011230800.1.70239 WP_011230800.1.78869 WP_011230800.1.8599 WP_011230800.1.91533 WP_011230800.1.93593 gi|375008277|ref|YP_004981910.1| gi|56419836|ref|YP_147154.1| 235909.GK1301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]