SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A098RFD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098RFD5
Domain Number 1 Region: 199-295
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 5.02e-30
Family DNA repair glycosylase, N-terminal domain 0.0019
Further Details:      
 
Domain Number 2 Region: 304-456
Classification Level Classification E-value
Superfamily DNA-glycosylase 2.62e-29
Family DNA repair glycosylase, 2 C-terminal domains 0.00076
Further Details:      
 
Domain Number 3 Region: 2-84
Classification Level Classification E-value
Superfamily Ada DNA repair protein, N-terminal domain (N-Ada 10) 5.75e-29
Family Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.00054
Further Details:      
 
Domain Number 4 Region: 138-185
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000211
Family AraC type transcriptional activator 0.036
Further Details:      
 
Domain Number 5 Region: 84-132
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000563
Family AraC type transcriptional activator 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A098RFD5
Sequence length 459
Comment (tr|A0A098RFD5|A0A098RFD5_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KGE78855.1} KW=Complete proteome; Reference proteome OX=42565 OS=Halomonas salina. GN=FP66_00785 OC=Halomonadaceae; Halomonas.
Sequence
MLDAAQCRQARLARDARFDGRFVVGVTSTGIYCRPICPAIPSKDTRVRYFDTPLAAAEAG
FRPCLRCRPDSAPDSPAWRGTRTTLERALRLIDDGALGDGSLSDLCQRLGVGERHLRRLF
HDGLGVSPKAYAQYRQCLFAKQLLHQTTLPITDIAYASGFRSLRRFNDAFVTRIGLAPRE
LRRSAADSAHAGQNGEPLTLWLAYRPPYAWPALRDFHAGRAIAGLEWVGEAYYGRHIRWD
GARGSFTAEHVPQRHAFRVRLVLDDLRALSPVVRRIRRVLDLDADTTTIETHLAGAFPGL
ALVEGLRLPGIWSPFEAGVRAILGQQVSTDAARGLVTRLVEARGEPTEHGHHFPVPEAIA
DSELDELRMPGARKATLRCFASWYAEGEADDDPQAWTTLKGIGPWTANYAALRGTGAPDI
WLDGDAGVRRALPRLAGADPARGAPWRSYLTLQLWSSTP
Download sequence
Identical sequences A0A098RFD5
WP_035593750.1.31973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]