SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A098TL78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098TL78
Domain Number 1 Region: 2-123
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.09e-47
Family Ribosomal protein S13 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A098TL78
Sequence length 127
Comment (tr|A0A098TL78|A0A098TL78_9CYAN) 30S ribosomal protein S13 {ECO:0000256|HAMAP-Rule:MF_01315} KW=Complete proteome; Reference proteome OX=1497020 OS=Neosynechococcus sphagnicola sy1. GN=DO97_03215 OC=Neosynechococcus.
Sequence
MARIAGVDLPRDKRVEIGLTYIYGIGLSRSQEILSQTGVNPDTRVKDLSDAEVTTLREAV
ESNYQVEGDLRRLESMNIKRLMDIGTYRGRRHRMGLPVRGQRTRTNARTRRGGRRTVAGK
KKAPSKK
Download sequence
Identical sequences A0A098TL78
WP_036532282.1.87483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]