SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A098VRG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098VRG7
Domain Number 1 Region: 57-183
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0000785
Family Capz beta-1 subunit 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A098VRG7
Sequence length 230
Comment (tr|A0A098VRG7|A0A098VRG7_9MICR) Uncharacterized protein {ECO:0000313|EMBL:KGG51560.1} KW=Complete proteome; Reference proteome OX=1485682 OS=Mitosporidium daphniae. GN=DI09_31p110 OC=Eukaryota; Fungi; Microsporidia; Mitosporidium.
Sequence
MEPNGKRHLQVLVIAKFADRLGSMNPLAGKKKPLNLVQMKSSRTMLLCKAALLSFRYYEG
SDSLCSFFITSTSPNGWDFIILIQSTIEHQKEDSDNHPSSYFSSWNSVHKGNVKLDEGSK
CCEYKLRSSVAVRSKKTCEKERENEAADSSNWNAPTLYQSLHLKHIGTLLESSESKLRLS
ILDIHSQAPSIALKSAFKFQSIGLSPKAMNPACQSEFLRKVQSRNATEQS
Download sequence
Identical sequences A0A098VRG7
XP_013237987.1.34016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]