SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A098VU30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098VU30
Domain Number 1 Region: 143-232
Classification Level Classification E-value
Superfamily MIR domain 0.00000000000209
Family MIR domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A098VU30
Sequence length 456
Comment (tr|A0A098VU30|A0A098VU30_9MICR) Uncharacterized protein {ECO:0000313|EMBL:KGG51216.1} KW=Complete proteome; Reference proteome OX=1485682 OS=Mitosporidium daphniae. GN=DI09_40p20 OC=Eukaryota; Fungi; Microsporidia; Mitosporidium.
Sequence
MQSDPDTSDNKSTASPKEEAIYKLSASTSASPGHLDRYDCFFIFLLFLPSCFTRFRFISV
PFDTVYAALVIIVGHPIKLCSYSKYIPVCLAADGRSYPQIHLDGKVSSGGTAVFGTSSLE
SPSGDSVWVLNFVSGEANGDLFANIYHPKTDSYLLTHDVASPLTLTNMEVTTTKDKFNPH
CVWKLLNVSLPVSSKSFIFKIVNNVTGTVLIDFERNLPEWGRYQREISSSSKVLLSGHPP
DRSCWSMYPETYRRGESPKTRSFWLKFVEHQILFYKFNMLLDGNHPAASDPISWPLHPGI
NKGVSFWDDIYLNKHIYLIGNPLAWILCVLALMVSLFALLVCFKSSKETLLFLPLGAWAF
HYLPYFLCRTKLLYLHYYLPAFSFSALAVGCMLQYFFRSGRASTLTAAILGLCAALIYCA
YLKISLFNNGVESLSNEILDFLSDSSSHPLSLLLMN
Download sequence
Identical sequences A0A098VU30
XP_013237661.1.34016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]