SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A099D6X3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099D6X3
Domain Number 1 Region: 247-512
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.32e-60
Family Pyruvate oxidase and decarboxylase Pyr module 0.076
Further Details:      
 
Domain Number 2 Region: 29-240
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 7.19e-16
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.013
Further Details:      
 
Domain Number 3 Region: 529-629
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000000000267
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A099D6X3
Sequence length 634
Comment (tr|A0A099D6X3|A0A099D6X3_9ACTN) 2-oxoglutarate ferredoxin oxidoreductase subunit alpha {ECO:0000313|EMBL:KGI81903.1} KW=Complete proteome; Reference proteome OX=414996 OS=Actinopolyspora erythraea. GN=CDG81_08970 OC=Actinopolyspora.
Sequence
MVATNGQRTESGPEEQQPDTLRKVNRVVIRFAGDSGDGMQLTGDRFTSEAAAFGNDLATL
PNYPAEIRAPAGTLPGVSSFQLHFADYDILTPGDRPDVLVAMNPAALKANLGDLPAGATV
VVNTDEFTKRNLKKVGYEQSPLETDELDRFTVHRVAMSELTKGAVAETGLTRKEAERCKN
MFALGLLSWMYHRPTDNTERFLREKFAGKPQVAEANLLAFRAGWNYGETTESFAVAYEVE
PASLPEGTYRQVTGNLALAYGLVAAGQRSELPVFLGSYPITPASDVLHEMAKHKNFGVTT
FQAEDEIAGVGAALGASFGGSLGVTTTSGPGLALKSETIGLAVALELPMLICDIQRGGPS
TGLPTKTEQADLLQALYGRNGESPVPVLAPRSPSDCFDIAMDAARIALTYRTPVLLLSDG
ATANGSEPWLIPDVSELPDLRVSFADSPNAPDGSEEFWPYQRDPRTLAREWAVPGTPGLE
HRVGGLEKLDGKGSISYDPDNHDAMVRLRQRRIDGIEVPDVSVEDPDGDARVLVLGWGSS
YGPIGAACRRLRARGMSVAQTHLRHLNPMPGNLGEVLRRYDRVVVPEMNMGQLAMLLRSR
YLVDAQSYTKVAGLPFQAEELENVLSDVVQGVEL
Download sequence
Identical sequences A0A099D6X3
WP_043571760.1.50518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]