SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099DFS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099DFS8
Domain Number 1 Region: 5-107
Classification Level Classification E-value
Superfamily Hypothetical protein YhaI 1.96e-16
Family Hypothetical protein YhaI 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A099DFS8
Sequence length 115
Comment (tr|A0A099DFS8|A0A099DFS8_9BACL) Uncharacterized protein {ECO:0000313|EMBL:KGI84696.1} KW=Complete proteome OX=340146 OS=Exiguobacterium mexicanum. GN=JY98_00150 OC=Bacillales Family XII. Incertae Sedis; Exiguobacterium.
Sequence
MENVSLEEKINQLSFQMELLLGAVDWSERPFEHEVLKANLTRQEVVAFFALLDDIRERQN
EQARYGLSSVEPLLVHFVGMLHPHLEAETILEACVRQGMALDVTEPLYRQVKLLY
Download sequence
Identical sequences A0A099DFS8
WP_034776519.1.80698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]