SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A099EB86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099EB86
Domain Number 1 Region: 150-335
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.14e-60
Family Methylesterase CheB, C-terminal domain 0.0000267
Further Details:      
 
Domain Number 2 Region: 1-105
Classification Level Classification E-value
Superfamily CheY-like 3.27e-21
Family CheY-related 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A099EB86
Sequence length 337
Comment (tr|A0A099EB86|A0A099EB86_9PSED) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=658612 OS=Pseudomonas sp. H2. GN=MD26_03255 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MKIAIVNDMPMAVEVLRRALAFEPAHQVIWVAGNGAEAVQRCAEQLPDLILMDLIMPVMD
GVEATRRIMGETPCAIVIVTVDRKQNVHRVFEAMGHGALDVVDTPALGAGDAREAAAPLL
RKILNISWLIGQQRSPAARPVATPLREASQRRGLVAIGSSAGGPAALEVLLKGLPPAFPA
AIVLVQHVDQVFAAGMAEWLSSAAGLPVRLACEGEPPQPGQVLLAGTNHHIRLLKNGQLA
YTAEPVNEIYRPSIDVFFESVARYWSGDAVGVLLTGMGRDGAQGLKLMRQQGFLTIAQDQ
ASSAVYGMPKAAAAIDAAVEIRPLERIAGRLMEFFAK
Download sequence
Identical sequences A0A099EB86
WP_047581556.1.25404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]