SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099EX86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099EX86
Domain Number 1 Region: 73-114
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.0000000000251
Family H-NS histone-like proteins 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A099EX86
Sequence length 115
Comment (tr|A0A099EX86|A0A099EX86_9RHOB) Uncharacterized protein {ECO:0000313|EMBL:KGJ03010.1} KW=Complete proteome; Reference proteome OX=690417 OS=Paracoccus sphaerophysae. GN=IC63_13920 OC=Rhodobacteraceae; Paracoccus.
Sequence
MTDIDLDALDLPQLKDLGRRIDQQIADLTRRQREEALLAAKAAASERGFDLAELLGQGRT
GRGRGRGQGQSQEKSAPRYANPNDPAQTWSGRGRRPAWVTEALEGGASLESLTIA
Download sequence
Identical sequences A0A099EX86

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]