SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A099F7C8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099F7C8
Domain Number 1 Region: 709-909
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.32e-27
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0063
Further Details:      
 
Domain Number 2 Region: 19-200
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000000306
Family Pyruvate oxidase and decarboxylase Pyr module 0.074
Further Details:      
 
Domain Number 3 Region: 430-605
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.000000000785
Family PFOR PP module 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A099F7C8
Sequence length 1132
Comment (tr|A0A099F7C8|A0A099F7C8_9RHOB) Indolepyruvate ferredoxin oxidoreductase {ECO:0000313|EMBL:KGJ06394.1} KW=Complete proteome; Reference proteome OX=376733 OS=Paracoccus halophilus. GN=IT41_01770 OC=Rhodobacteraceae; Paracoccus.
Sequence
MSVQEFSLSDRFDLKRRHVLLNGTQALVRLMLMQAARDRAAGLNTAGFCTGYRGSPLGAV
DLQMMKSDKELKAASVLFQPGLNEDLAATSIWGSQQAELRGEGRYDGVFALWYGKGPGVD
RSGDVMRHANMAGSSRHGGVVMAMGDDHTGESSTVLHQSDWAMVDAYIPVLSPAGVQEIL
DFGLYGFALSRFAGVWTGLKTMKDTVEATSVVDGDPERLRFVTPDFAMPEGGLNIRLGDT
PVAQEARMIDYKRFAAEAFARANRIDRMVWGKPGARIGFVAAGKNWLDLTHALSLLGIDE
AEAERLGISTYKVGQTWPMDMKSFQEWSENLEILVVVEEKRKLIEVQVKEAIFDNRHGRR
VLGWKHDRTGEELFPTRFALDPVMIAQKLGAILIEEGRGTEAIKAGLQRLTEVRRNDNAP
EIVTRTPWFCSGCPHNTSTRLPEGARAYAGIGCHYMVQWMGRETQGFTHMGGEGVNWVGE
APFSKRKHVFQNLGDGTYNHSGSLAIRAALAAGTSITYKILFNDAVAMTGGQPNEGGLTA
SQIARELHAMGVSPVVVVYDEKEDVDRGEFPPNMRFEERESMLAVQKELEEVGGVSAILY
IQTCAAEKRRRRKRGLFPDPDRRIWINPEICEGCGDCGVQSNCVSIVPRDTELGRKRAID
QSSCNKDYSCVKGFCPSFVSVRGAKLRRPRAAALDLPEMPAPALPAIRGTHNIVVTGVGG
TGVVTIGAVLAQAAHIDGKGAGMMEMAGLAQKGGAVHIHLRLANAPGDISAIRVAVGEAD
CVIGGDLVVTGGAKTIGLMTNGRTGAVVNDHEIITGDFTRQRDFQVPSDRLRLSLEARLG
DKVALFDASTLALRLLGDSIYSNMLVLGASWQRGLLPLGEEAILKAIELNGAKVAENQRA
FQIGRWAILHPDKAAELIAGPAQQDEAVDPVAYRAARLVDYQNTALASRFRDFVAQAPEE
LRESVARGYYKLLAYKDEYEVARLHLDSARQVLEEFEEGGRLSFHLAPPVLPGRDPDGRP
RKREFGAWVLPVFRLLARMKGLRGTALDPFGWLPERRAERAAIAEYESDMRDVWPQARPE
TLELIRELAELPLSVRGYGPVKEESAKQAAARRLWLLDAIRQGGTPLAQAAE
Download sequence
Identical sequences A0A099F7C8
WP_036738300.1.47220 WP_036738300.1.64823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]