SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099GIA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099GIA3
Domain Number 1 Region: 6-200
Classification Level Classification E-value
Superfamily ITPase-like 1.91e-61
Family ITPase (Ham1) 0.0000787
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A099GIA3
Sequence length 201
Comment (tr|A0A099GIA3|A0A099GIA3_9RHOB) Nucleoside-triphosphate pyrophosphatase {ECO:0000256|HAMAP-Rule:MF_01405} KW=Complete proteome; Reference proteome OX=1545044 OS=Paracoccus sanguinis. GN=IX56_08655 OC=Rhodobacteraceae; Paracoccus.
Sequence
MSAWAGRTLLIATHNAGKLEEMRALFAPLGITVTGAAEHGLPEPAETEESFVGNARIKAR
AAMEATGLPVLADDSGITVDGLDGAPGVHTADWAETGAGRDFMQAMRRTWEALEARNVPE
PRRAQFRATLVLLTPEGEEQVFEGVAPGRLVWPPRGALGHGYDPMFIPDGHDRTYAEMDF
AEKNAISHRARAFAALEAALA
Download sequence
Identical sequences A0A099GIA3
WP_036709293.1.45779 WP_036709293.1.99895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]