SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099HZ07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099HZ07
Domain Number 1 Region: 3-62
Classification Level Classification E-value
Superfamily DNA-binding domain 2.03e-25
Family DNA-binding domain from tn916 integrase 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A099HZ07
Sequence length 62
Comment (tr|A0A099HZ07|A0A099HZ07_CLOIN) Integrase {ECO:0000313|EMBL:KGJ50979.1} KW=Complete proteome OX=1522 OS=Clostridium innocuum. GN=CIAN88_23820 OC=Erysipelotrichaceae; Erysipelatoclostridium.
Sequence
MKEKRRDSKGRILHTGESQRTDGEYLYKYVDAFGNTKYVYAWRLTPTDPTPKGKREKPSL
RE
Download sequence
Identical sequences A0A099HZ07

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]