SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099MZQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099MZQ6
Domain Number 1 Region: 1-143
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 1.05e-42
Family PA0094-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A099MZQ6
Sequence length 155
Comment (tr|A0A099MZQ6|A0A099MZQ6_9PSED) DUF1795 domain-containing protein {ECO:0000313|EMBL:PBJ92935.1} KW=Complete proteome OX=70775 OS=Pseudomonas plecoglossicida. GN=CMV24_24255 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MDYELQEGGIALPAGFEDRTVNMFVLGASVPAPLSITISRDTLLPDEALQAYVDRQVKML
TSKLRGYTRMGNKAVSLSATAPIAGIQIDAYYMNQGRPLYQRQAAFIISPGRALIFSTTA
QADFSAQQNQDWDNLLASFTPRAPSVTSAESGEQE
Download sequence
Identical sequences A0A059USU7 A0A099MZQ6 A0A0C1I7S7 F8FXL3 J8UT41 V7D7I2 V9V0W4
gi|339487729|ref|YP_004702257.1| WP_003260502.1.1643 WP_003260502.1.23948 WP_003260502.1.28354 WP_003260502.1.35335 WP_003260502.1.56258 WP_003260502.1.65739 WP_003260502.1.7288 WP_003260502.1.7435 WP_003260502.1.80759 gi|568182382|ref|YP_008955005.1| gi|568187760|ref|YP_008960373.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]