SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A099P3E5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099P3E5
Domain Number 1 Region: 409-603
Classification Level Classification E-value
Superfamily MIR domain 8.11e-53
Family MIR domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A099P3E5
Sequence length 1324
Comment (tr|A0A099P3E5|A0A099P3E5_PICKU) Uncharacterized protein {ECO:0000313|EMBL:KGK39405.1} KW=Complete proteome; Reference proteome OX=4909 OS=Pichia kudriavzevii (Yeast) (Issatchenkia orientalis). GN=JL09_g1441 OC=Saccharomycetes; Saccharomycetales; Pichiaceae; Pichia.
Sequence
MPAKQRGGASRSLSATEAKELEELRELPNQRNSIVSDIQSLDQRRQSAEYFEEKRGSISY
SASSFSEGTQLVREDGAKLLEKSYSMANTGVTRNSLISGLKLLSKETTELEIKADQLGAK
KRRLVNGIFHKYIAPVIFTVISFWLRYYKIGDNNTVIWDEAHFAKFGSFYNRHTFYHDVH
PPLGKMLCGLSEWLVGYQASANPDYNFDAGSTYPAQINYFGMRLFQVFFSSALTPIAWFT
CRSLKKNLWTCYLVTLMVCLESSFIVLGKFVLLDSFLFFFTATTFLCLANVNRLRKFEGK
SRKFNLWLLLLGLSIGCVCCVKWVGLFVTSVVGVYVIVDLWAKFWEPNFRILTYAHYWFT
RIIALICIPVVVYLTCFKLHLDLLYLPGDGSASMNTIFQANMRATDIVSQPRFVQFGDEL
TLRSQGPNSNLLHSHQQVYPAGSGQHQVTTYGFKDSNNNWQIENPRTARKLSGYLKDGDT
LRLKHLMTGANLHSHEIPGHVSKNYFEVSGYGSEETGDEKDDWIVEVVSQLYSSNETYRI
MNESGDQFHKFIHPVSTTFRLKHKQLGCYLGTTGKSYPIWGFQQGEVVCLDAAPKDSWKS
YIDTSANWNIESVVSSGIPIDYEYEYPKSNFLKDFIQIQRSMAASNNALTPDPSKADSIA
SSWWEWPIMRSGIRMSTWSLSARRYYMFGNPIIIWFTTACVVVYSFIMFSISRRWKSQEL
VLDEVAMWNIFTSGIVPLLGYILHYLPFIVMGRVTYFHHYMPALYFAMFMSGFAVDYLTI
NMNKRIRDVIYFLLFVVIIGSFWLFSPTCLGMVGHPRNYKYLNWFPTWTMSDYQPFSITL
QQFFSKCNQTPEDKENHVTLRVSGQLLYGVVKIYSRKTRYLYDDVSMALLQLRSAFAVSK
SLTVPLEDTIVSLESITMKDRITEANIIDTDFNLDEVFGGSSKNSQMRTWTQEDSQSDDY
ALGDISIGRGVDEDVGNVSIDALARRAEPELDDLDHVPEFELPLDFDKGIGPDIETVAGI
ANYNIEAADNMDLEFTIDETHMENEELQNKQTEMRSNNIFGNEGVEEGEGEGEGEGEGGE
EEEEEERAILMKRPRRTYQRKSYDNLSVIRTNRKRLVIDETNEIATNVLKKSQRDFPPKP
ESKLQFNIQIVMENLNPEFLKRVGTSWMSVKRRKLREKTDSSYNETFADTPLYDENENEI
SGYEVPEFTINEPTEIEQEEEHASKGHVSDFETFSPGVSVPEEDEQEEEEPEEGEEEEPV
ELNERSDERTIQVASALRAKFADTQVSFVSFDNIPVELSKNTKSNATRTFFELLVLGTSD
CLEK
Download sequence
Identical sequences A0A099P3E5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]