SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A099P720 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099P720
Domain Number 1 Region: 544-731
Classification Level Classification E-value
Superfamily MIR domain 6.8e-24
Family MIR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A099P720
Sequence length 958
Comment (tr|A0A099P720|A0A099P720_PICKU) Uncharacterized protein {ECO:0000313|EMBL:KGK40049.1} KW=Complete proteome; Reference proteome OX=4909 OS=Pichia kudriavzevii (Yeast) (Issatchenkia orientalis). GN=JL09_g787 OC=Saccharomycetes; Saccharomycetales; Pichiaceae; Pichia.
Sequence
MLKNFSRTLSRWNFVQRGRVARFVSQAPVIARRNLSSKKTQKTEAKLSFEEESDLYVLGE
VISSIEKYNAENKRVTEVVEQFKHAFLLNGIEIVKAPVPGLESTKTDILHFSKSVDGTTK
IDLIVDFKKVFNEDAREIQVVITDETKVSQLFYLMGDFSREDGMLFSNSMMIDSLEYNKT
AVELRDAICDGEAWVFRMLNNKFQKPLDVRNVNVVKFLSNIKRDAGEALDSLDSRTFVDA
LINYTVLTHLGVLKGHDEGDKLNTNVYELFQLLAAVTITIVIRLYCIEFPNKVLLEEIPI
VSAINSYLTGRFFLDINPPFVPLLFSALSRSLGYGVFTFEELSINSEYDSFPYQHLRVLN
AIVGGLAVIYIYKILKISAVNHYYALFGVFLFALENSMITQSRFMFTDSFYILFVAIFVC
HHKLMSLKTKFSASWFFNLLICTTALGLTISTHWSGLFLIVYAFLSSTITFWIASGDIDV
SMNYLRIASLIKDFAYLTIPFTIYLYFFKLHLSHLDSRGESYNLLSPAYQHSLKETHLDG
LIADVSYGSTVMIRHFKSGEYLHSHNDFYRTSKHQQVTLFDNFDDFNNFFKIYPVKGNSD
RIMNDAMKIFVPHKVKIKHVATDSFLVADSDFKPPLSEQEYNSEVTTQKVFSKMEEDTSE
FQLKISTKYTKDEKARVSLRAIESVFQIYNKRSDCYLLGTPLLLTEGFAESQHELICIKE
PEYEASLWYIDWNKHDKYSIDSGLVDFPELGFWDKFVEIHFKVFKKLFVGDIGYNNGSSV
SFTDWLFLRKGYVHFLDTEAHSAVYLLGNYITYHLVILVIFIYSVFKAYQLMTTNPYQHC
TTVDVSVYIYDHQMLDLILGYTLTLLLRKFVKIDLQLFDYLPILFFGILCVPQTFQLGHS
KAPKFTFFLTIISCLLVFLAFKKYSPLIYGLQWSYERCMKMMVGPGWDSGVCKVYYPF
Download sequence
Identical sequences A0A099P720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]