SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099SIT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099SIT1
Domain Number 1 Region: 3-61
Classification Level Classification E-value
Superfamily XseB-like 1.83e-16
Family XseB-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A099SIT1
Sequence length 72
Comment (tr|A0A099SIT1|A0A099SIT1_9FIRM) Exodeoxyribonuclease 7 small subunit {ECO:0000256|SAAS:SAAS00387558} KW=Complete proteome OX=1487923 OS=Desulfosporosinus sp. HMP52. GN=DP73_02195 OC=Desulfosporosinus.
Sequence
MGLQTLEEIVRMLEQKDLPLEKALNLFKDGVGLVQYCSQVLDQAEKQMEILLEGSDGQLQ
IKPASFDGKDER
Download sequence
Identical sequences A0A099SIT1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]