SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A099T182 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099T182
Domain Number 1 Region: 1-193
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 6.54e-47
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A099T182
Sequence length 211
Comment (tr|A0A099T182|A0A099T182_METMT) Indolepyruvate oxidoreductase {ECO:0000313|EMBL:KGK98629.1} OX=2226 OS=Methanococcoides methylutens. GN=LI82_07130 OC=Methanosarcinaceae; Methanococcoides.
Sequence
MKFDILIAGVGGQGVVLASRLLATAAIDAGYHVATAETIGMAQREGSVTSHVRIGDEVCG
SLIPAGNADLIIGLEPAEAARNIHFLSKDGSIVVNEHAVIPSASANNAEYIPEHVIEFLK
ENCQETINVDFTQLAKEAGTYRATNVAMLAAAAGADLLPFNPEELWSVLEKMVPEKYREL
NRKAFDMSLERVSGMKDPEKQEQVQVQAMDT
Download sequence
Identical sequences A0A099T182
WP_048194417.1.7208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]