SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A099U1I1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099U1I1
Domain Number 1 Region: 1-186
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.09e-39
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A099U1I1
Sequence length 186
Comment (tr|A0A099U1I1|A0A099U1I1_9HELI) Pyruvate ferredoxin oxidoreductase {ECO:0000313|EMBL:KGL14642.1} KW=Complete proteome OX=471858 OS=Helicobacter magdeburgensis. GN=LS74_10275 OC=Helicobacteraceae; Helicobacter.
Sequence
MLEIRWHSRAGQGAVTGAKGLADVIAGTGKEVQAFAFYGSAKRGASMTAYNRIDSEPILN
HEKFMNPDYILVIDPGLVFITNICLYDKPSTKYIITTRLSKEELIEKKPELATKELYTLD
CIQISIDAIGKSVPNAPMLGALMKVSGMLEIDYFLESFSKVLGKKLPQKVIDANKVAIRR
AYEEVK
Download sequence
Identical sequences A0A099U1I1
WP_034589386.1.20517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]