SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A099U3G6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099U3G6
Domain Number 1 Region: 25-209
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.79e-64
Family Methylesterase CheB, C-terminal domain 0.00000293
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A099U3G6
Sequence length 219
Comment (tr|A0A099U3G6|A0A099U3G6_9HELI) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=135569 OS=Helicobacter apodemus. GN=LS72_09340 OC=Helicobacteraceae; Helicobacter.
Sequence
MLGNYDKHHPDLLLASSPYDGEGKKIIGIGASTGGIDAIVKILQNLPLNLPPIVITQHIP
AGFSTSFAERLDEISVMKVYEVNKKMLLKSSCAYLAAGGTHLLLKRSGNEYSAEPLEGER
ISRHKPSVDIMFRSLNNVAGKNALGIILTGMGDDGSIGIKELHKNGAYTIAQDEASCVVF
GMPKQAISRGAITEVVSLEDIPLRIIKFSQGILINNRSE
Download sequence
Identical sequences A0A099U3G6
WP_034555198.1.5428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]