SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A099VFH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099VFH4
Domain Number 1 Region: 3-180
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.75e-35
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A099VFH4
Sequence length 184
Comment (tr|A0A099VFH4|A0A099VFH4_9HELI) 2-oxoglutarate:acceptor oxidoreductase {ECO:0000313|EMBL:KGL31592.1} KW=Complete proteome OX=50960 OS=Helicobacter trogontum. GN=LS80_09570 OC=Helicobacteraceae; Helicobacter.
Sequence
MEHQLRFTGVGGQGVLLAGEILAEAKIRGGGYGVKASTYTSQVRGGPTKVDILLDSEDIL
YPYAMDGNIDFMLSVAQMSYDIYKSGIKEQGIVVLEPNLVKPTDEDRQRFRIYEIPIITI
AKEEVGNVVTQSVVALAATVTFTNCVSEELVIETMLSKVPAKVADLNKKAYELGKKYALE
CLNK
Download sequence
Identical sequences A0A099VFH4
WP_034322343.1.16891 WP_034322343.1.23457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]