SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099YYI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099YYI7
Domain Number 1 Region: 1-118
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 8.89e-40
Family TRAPP components 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A099YYI7
Sequence length 119
Comment (tr|A0A099YYI7|A0A099YYI7_TINGU) Trafficking protein particle complex subunit 6B {ECO:0000313|EMBL:KGL73630.1} KW=Complete proteome; Reference proteome OX=94827 OS=Tinamus guttatus (White-throated tinamou). GN=N309_00868 OC=Coelurosauria; Aves; Palaeognathae; Tinamiformes; Tinamidae; Tinamus.
Sequence
GFRVGQGLIERFTKDTSRFKDELDIMKFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKF
RLLTQMSAGKQYLEHAPKYLAFTCGLIRGGLSNLGIKSIVTAEVSTMPACKFQVMIQKM
Download sequence
Identical sequences A0A099YYI7
XP_010225563.1.20684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]