SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099Z0U4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099Z0U4
Domain Number 1 Region: 11-203
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.43e-32
Family Ankyrin repeat 0.00051
Further Details:      
 
Domain Number 2 Region: 229-270
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000249
Family SOCS box-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A099Z0U4
Sequence length 272
Comment (tr|A0A099Z0U4|A0A099Z0U4_TINGU) Ankyrin repeat and SOCS box protein 1 {ECO:0000313|EMBL:KGL76084.1} KW=Complete proteome; Reference proteome OX=94827 OS=Tinamus guttatus (White-throated tinamou). GN=N309_06788 OC=Coelurosauria; Aves; Palaeognathae; Tinamiformes; Tinamidae; Tinamus.
Sequence
SRINEKSVWCCGWLPCTPLRIAATAGHGPCVDFLLQKGAEIDLVDVKGQTALYVAVVNGH
LECAKILLEAGADPNGSRHHRSTPVYHAARVGRADILQELIRYGADVDVNHHLASRLPSP
SLRPLTTLVVCPLYISAAYHNLQCFRLLLQAGANPDFNCCGPINIQGFSRGSPVCVMDAV
LRHGCEAAFVHLLIDFGANLNLVKVEALGGESTGRVKVNPEALQVFEEARGRTRSLLSLC
RIAVRRILGKCRLDLIHSLPVPDPIKQFLLHE
Download sequence
Identical sequences A0A099Z0U4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]