SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A099ZIW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099ZIW7
Domain Number 1 Region: 179-356
Classification Level Classification E-value
Superfamily MIR domain 6.37e-51
Family MIR domain 0.0019
Further Details:      
 
Domain Number 2 Region: 1042-1157
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-17
Family SPRY domain 0.023
Further Details:      
 
Domain Number 3 Region: 3958-4036
Classification Level Classification E-value
Superfamily EF-hand 0.000000000214
Family Calmodulin-like 0.027
Further Details:      
 
Domain Number 4 Region: 621-754
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000989
Family SPRY domain 0.048
Further Details:      
 
Domain Number 5 Region: 63-144
Classification Level Classification E-value
Superfamily MIR domain 0.00000641
Family MIR domain 0.021
Further Details:      
 
Domain Number 6 Region: 1373-1494
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000111
Family SPRY domain 0.022
Further Details:      
 
Domain Number 7 Region: 382-510
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000128
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 
Domain Number 8 Region: 2107-2173
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000902
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A099ZIW7
Sequence length 4917
Comment (tr|A0A099ZIW7|A0A099ZIW7_TINGU) Ryanodine receptor 2 {ECO:0000313|EMBL:KGL80765.1} KW=Complete proteome; Reference proteome OX=94827 OS=Tinamus guttatus (White-throated tinamou). GN=N309_01010 OC=Coelurosauria; Aves; Palaeognathae; Tinamiformes; Tinamidae; Tinamus.
Sequence
NVPPDLSICTFVLEQSLSVRALQEMLANTEEKAEGGLILFQGPTMSFLFVFQSAQGGGHR
TLLYGHAILLRHSYSGMYLCCLSTSRSSMDKLAFDVGLQENTTGEACWWTIHPASKQRSE
GEKVRVGDDLILVSVSSERYLHLSYGNGSLHVDAAFQQTLWSVAPISSGSEVAQGYLIGG
DVLRLLHGHMDECLTVPSGEHGEEQRRTVHYEGGAVSIHARSLWRLETLRVAWSGSHIRW
GQPFRLRHITTGKYLSLLDDRSLLLTDKEQADVKSTAFCFRSSKEKLDVGTRKEVDGMGA
PEIKYGDSICFIQHVDTGLWLTYQSADAKSVRMGSVQRKAIMHHEGHMDDGLTLSRSQHE
ESRTARVIRSTVFLFNRFIRGLDALSKKAKSSTVDLPIESVSLSLQDLIGYFHPPDEHLE
HEDKQNRLRALKNRQNLFQEEGMINLVLECIDRLNVYSSAAHFGDVAGKEAGEAWKSILN
SLYELLAALIRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKE
GHIKSIICLLDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNH
VSSMRPNIFLGISEGSAQYRKWYYELMVDHLEPFVTAESTHLRVGWASTEGYSPYPGGGA
EWGGNGVGDDLYSYGFDGLHLWSGCVARTVNSPNQHLLRTDDVISCCLDLSAPSISFRIN
GQPVQGMFENFNIDGLFFPVVSFSACLVRFLLGGRHGEFKFLPPPGYAPCFEAVLPKEKL
KVEHSREYKQDRSYTRDLLGPTISLSQAAFTPVPVDTSQIVLPPHLERIREKLAENIHEL
WVMNKIELGWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGSHVGI
ADEHAEEKVKKMKLPKNYQLSSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRI
RQGWTYGIQQDVKNRRNPRLVPYALLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHA
TRLDMCMGIIEKFRIFRTEKTYAVKTGKWYFEFEAVTAGDMRVGWTRPGCLPDQELGSDE
EAFVFDGFKAQRWHQGNEHFGRSWLAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAF
KDFEVGDGFLPVCSLGLSQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITIWLS
KRLPQFLPVPLNHEHIEVLRIDGTIDSCPCLKVTQKSFGSQNSKTDVMFFRLSMPIECAE
VFSRTAAGGLPGTGLYGPKNDLEDYDADSDFEVLMKTAHGHLVPDRTEREKEVTKTELNN
HKDCAQEKPSRLKQRFMLRRTKPDYSTSHSARLTEDVLADDRDDYDYLMQTSTYYYSVRI
FPGQEPANVWVGWITSDFHQYDTTFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGE
SMSPGQGRNNNGLEIGCLVDAASGLLTFTANGKELGTYYQVEPSTKLFPAVFAQATSPNV
FQFELGRIKNVMPLSAGLFKSEHKNPVSQCPPRLHVQFLTHVLWSRVPNHFLKVDVSRIS
ERQGWMIQCMNPLQFMALHIPEENRTIDILELTEQEELLKFHYHTLRLYSAVCALGNNRV
AHAMCSHVDESQLLYAIENKYMPGLLRAGYYDLLIDIHLNTYATARLMMNNEFIVPMTDE
TKSITLFPDENKKHGLPGIGLSTSLRPRMQFSSPSFVSISSECFQFSPEFPLEILKAKTI
EMLTEAVQEGSLHVRDPVGGSTEFLFVPLIKLFYTLLIMGIFHNGDLKHILQLIEPRVFK
EAMSQEDESDFSEKELSSDELKAEEGEEETKGEQVPKEGLLQMKLPEPVKLQMCHLLQYL
CDCQVRHRIEAIVAFSDDFVARLQENQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQI
NMLLNFKDDKNDCPCPEEIRDQLLDFHEDLMAHCGIELDEDGSLDGNNDLTIRGRLLYLM
EKVTYLKKKQTEKPVDDDAKTSSTLQQLISDTMVRWAQESVIEDPELVRAMFVLLHRQYD
GIGGLVRALPKTYTINSVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNK
VFYQHPNLMRALGMHETVMEVMVNVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKA
MFDHLSYLLENSSVGLASPSMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCG
LQSCPLLVSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGP
ALRGEGGNGLLAAMEEAIKISEDPTRDGRSPSNGSSKTLEMEEQEDDTIHMGNAIMTFYA
ALIDLLGRCAPEMHLLHAGKGEAIRIRSILRSLIPLEDLVGVISIPFHMPTIAKDGTVVE
PDMSAGFCPDHKAAMVLFLDRVYGIEDQDFLLHLLEVGFLPDLRAAASLDTAALSATDMA
LALNRYLCTAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEECL
LSICGQLRPSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAA
SEEELHLSRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQS
SMDSDGNFNPQPVDTSNITIPEKLDYFINKYAEHSHDKWSMEKFANGWVYGETYSESAKV
QPLMKQYKLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQI
SVDTAHGYSPRAIDMSNVTLSRDVHAMAEMMAENYHNTWAKKKKLELEAKGGGNHPLLVP
YDTLTAKEKAKDREKAQDILKFLQINGYVVSRGLKDLELDTPSIEKRFAYSFLQQLIRYV
DEAHQYILEFDGGSRGKGEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLSSG
GHASNKEKEMVTSLFCKLGVLVRHRISLFGNDAASIVNCLHILGQTLDARTVMKTGLESV
KMALRAFLDNAAEDLEKTMENLKQGQFTHTRNQPKGVTQIINYTTVALLPVLSSLFEHIG
QHQFGEDLILEDVQVSCYRILASLYALGTSKSIYVERQRSALGECLAAFSGAFPVAFLET
HLNKHNTYSIYNTKNARDRAVLNLPTSVEEVCPNIPSLVKLMEEIVELAESGIRYTQMPH
IMEVILPMLCSYMSHWWEHGPENNPDKAEMCCTALTSEHMNTLLGNILKIIYNNLGIDEG
AWMKRLAVFSQPIISKAKPQLLKTHFLPLMDKLKKKAAVVVSDEEHLRAEGRGDMSEAEL
LILDEFTTLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFK
REEQNFVVQNEINNMSFLITDTKSKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRL
LPIGLNICAPGDQELIALAKNRFSMKDTEDEVRDIIRSNLHLQGKLEDPAIRWQMALYKD
LPNRTEDSSDPEKTVERVLDIANVLFHLEERCVIYFFPVYFIYQVEHPQRSKKAVWHKLL
SKQRKRAVVACFRMAPLYNLPRHRAVNLFLQGYDKSWIETEEHYFEDKLIEDLAKPGEEP
PEEDEGLKRVDPLHQLILLFSRTALTEKCKLDEDFLYMAYADIMAKSCHDEDDDDGEEEV
KSFEEKEMEKQKLLYQQARLHDRGAAEMVLQTISASKGEMGPMVAATLKLGIAILNGGNS
TVQQKMLDYLKDKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVMQ
DDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWY
YSGKDVIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVF
AHMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVE
MILKFFDMFLKLKDLTSSDAFKEYDPDGKGIISKRDFHKAMESHKHYTQSETDFLLSCAE
TDENETLDYEEFVKRFHEPAKDIGFNVAVLLTNLSEHMPHDTRLQTFLELSESVLNYFHP
FLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVN
FCEDTIFEMQLAAQISESDLNERSANKEENEKDKPEDQDPRMGFFSLVTMKSALVALKYN
LMTLMKMLSVKSLKKQMKKVKKMTMKDMILALFSSYWSILMGLLHFACSVFRGFFRIVYS
LLLGGSLVEGAKKIKVAELLANMPDPTQDEVRGEGEEGERKPTETALPAEDLTDLRTLSD
DSDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLLSTPSIVPMPEVQEKAQEQVKEDEKE
EKEETKSEPEKAEGEDGEKEDKAKEDKGKQKLRQLHTHRYGEPDVQESAFWKKIIAYQQK
LLNYFARNFYNMRMLALFVAFAINFILLFYKVSTSAVAEEKEVPVVPAGESSKLNSLESD
NSRVIAVHYVLEESSGYMEPTLRILAILHTVISFFCIIGYYCLKVPLVIFKREKEVARKL
EFDGLYITEQPSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELL
GMDKAALDFSDAREKKKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSI
LGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFR
KFYNKSEDGDMPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITF
FFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTL
QEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
Download sequence
Identical sequences A0A099ZIW7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]