SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0AMZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0AMZ0
Domain Number 1 Region: 59-128
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 3.79e-20
Family F1F0 ATP synthase subunit C 0.0048
Further Details:      
 
Weak hits

Sequence:  A0A0A0AMZ0
Domain Number - Region: 2-52
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.000107
Family F1F0 ATP synthase subunit C 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A0AMZ0
Sequence length 129
Comment (tr|A0A0A0AMZ0|A0A0A0AMZ0_CHAVO) V-type proton ATPase proteolipid subunit {ECO:0000256|RuleBase:RU363060} KW=Complete proteome; Reference proteome OX=50402 OS=Charadrius vociferus (Killdeer) (Aegialitis vocifera). GN=N301_13103 OC=Charadrius.
Sequence
ALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANALSPSITL
FKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGL
IVALILSTK
Download sequence
Identical sequences A0A087QI76 A0A091H166 A0A091JJD8 A0A091QLB3 A0A091WFS9 A0A093NZ64 A0A0A0AMZ0 R0JHQ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]