SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0BLF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0BLF2
Domain Number 1 Region: 73-259
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.71e-52
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00034
Further Details:      
 
Domain Number 2 Region: 2-72
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0000000000127
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A0BLF2
Sequence length 274
Comment (tr|A0A0A0BLF2|A0A0A0BLF2_9CELL) Chemotaxis protein CheR {ECO:0000313|EMBL:KGM08685.1} KW=Complete proteome; Reference proteome OX=947969 OS=Cellulomonas carbonis T26. GN=N868_06040 OC=Cellulomonas.
Sequence
MSLTTESFTFVADLVRRRSAIQLETGKEYLVESRLLPLARAAAAADVDAYVRALRVMPQP
AAMDAVVEALTTNETSWFRDAQPFQALVEHVVPQAREARGGATDLRIWSAACSSGQEPYS
IAMALADALPGLTPTIVATDLSEEMVRRARAGRYSQLEVNRGLPAAMLVKHFTRVGTEWE
ISASLRDRVRFERHNLLDLPPAGGPFDVVFLRNVLIYFDLETKRQVLRRVQQVLRPGGFL
LLGAAETTIGVDDAWERVPVGRGSVYRSTARRAA
Download sequence
Identical sequences A0A0A0BLF2
WP_043610256.1.23122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]