SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0CND1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0A0CND1
Domain Number - Region: 47-121
Classification Level Classification E-value
Superfamily GAT-like domain 0.0137
Family GAT domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A0CND1
Sequence length 128
Comment (tr|A0A0A0CND1|A0A0A0CND1_PHOLU) UPF0325 protein B5C26_15155 {ECO:0000256|HAMAP-Rule:MF_01519} KW=Complete proteome OX=29488 OS=Photorhabdus luminescens (Xenorhabdus luminescens). GN=B5C26_15155 OC=Morganellaceae; Photorhabdus.
Sequence
MYDNLKSLGITYPEEIDRYSLRQEANNDILKIYFRKDKGEFFAKSVKFKYPRQRKTVTAN
NTEQGYKEINEINTNLRYVIEELDQICKRDQAEVDLKHKILDDLRHLEHVVANKIAEIEA
DLEKLTRK
Download sequence
Identical sequences A0A022PCV7 A0A0A0CND1
WP_036781518.1.2004 WP_036781518.1.20959 WP_036781518.1.25635 WP_036781518.1.4469 WP_036781518.1.53218 WP_036781518.1.80160 WP_036781518.1.8768 WP_036781518.1.93466 WP_036781518.1.94638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]