SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0A0CTE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0CTE2
Domain Number 1 Region: 157-342
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 7.45e-75
Family Methylesterase CheB, C-terminal domain 0.000000059
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 5.98e-28
Family CheY-related 0.00000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A0CTE2
Sequence length 350
Comment (tr|A0A0A0CTE2|A0A0A0CTE2_PHOLU) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=29488 OS=Photorhabdus luminescens (Xenorhabdus luminescens). GN=KS18_05160 OC=Morganellaceae; Photorhabdus.
Sequence
MNKITVLCVDDSALMRQIMREIINSHPDMEVVACAPDPLVARDLIKKHNPQVLTLDVEMP
RMDGIDFLEKLMRLRPMPVVMISSLTAKGSEITLRALELGAVDFVTKPQLGIREGMLAYS
ELIAEKIRTAAQAKLSVPIATPINSVPLSFKPLLSSEKLIAVGASTGGTEAIKNLLQPLP
VTSPALLITQHMPPGFTRSFAERLNKLSQITVKEAENGERILPGHAYIAPGDRHMELCRN
GADYQILITDAPAVNRHRPSVDVLFRSVAKFAGRNAVGVLLTGMGSDGAAGLLEMKQAGA
YTLAQDEASCVVFGMPRAAIQMGAVDEVMDIHKISKKMLAKISLGQAVRI
Download sequence
Identical sequences A0A0A0CTE2
WP_036807330.1.20959 WP_036807330.1.4469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]