SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0CVH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0CVH3
Domain Number 1 Region: 4-57
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 3.92e-17
Family H-NS histone-like proteins 0.00023
Further Details:      
 
Domain Number 2 Region: 92-134
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.0000000000302
Family H-NS histone-like proteins 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A0CVH3
Sequence length 134
Comment (tr|A0A0A0CVH3|A0A0A0CVH3_PHOLU) DNA-binding protein {ECO:0000256|PIRNR:PIRNR002096} KW=Complete proteome OX=29488 OS=Photorhabdus luminescens (Xenorhabdus luminescens). GN=KS18_01815 OC=Morganellaceae; Photorhabdus.
Sequence
MSDLKTLNNIRTLRAQARECQLEFLDEILEKLTVVVEERREEESQVQAELEERTRKLEEV
RKMILDQGIDPSELLQTMSAGKSAGKTKRPARPAKYQYVDTNGETKTWTGQGRTPAVIKK
AIEEEGRTLESFLL
Download sequence
Identical sequences A0A022PKC2 A0A0A0CVH3
WP_036777152.1.4469 WP_036777152.1.53218 WP_036777152.1.93466 WP_036777152.1.94638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]