SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0D889 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0D889
Domain Number 1 Region: 1-194
Classification Level Classification E-value
Superfamily BB2672-like 7.98e-73
Family BB2672-like 0.000000312
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A0D889
Sequence length 194
Comment (tr|A0A0A0D889|A0A0A0D889_9PROT) Peptide synthetase {ECO:0000313|EMBL:KGM34891.1} KW=Complete proteome; Reference proteome OX=1398085 OS=Inquilinus limosus MP06. GN=P409_07640 OC=Rhodospirillaceae; Inquilinus.
Sequence
MNAKIRKIVTVVEETVTEMGRPVTPPTRRAAAVAVIENPFAGRYAEDLTGLFEIGEELGG
LLAEKAVAALGIEGPAAESYGKAAAVGENGELEHAAAILHPKLGTPVRRVLGKGAALIPS
SKKRGGPGVALDIPLGHKDAAYVRSHFDGMEVRIADAPRAGEIMVAVAVTDSGRPLPRVG
GLKASEIKGEDGLR
Download sequence
Identical sequences A0A0A0D889
WP_034833852.1.40718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]