SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0A0HPD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0HPD7
Domain Number 1 Region: 713-913
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.22e-26
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.015
Further Details:      
 
Domain Number 2 Region: 434-620
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000000569
Family PFOR PP module 0.083
Further Details:      
 
Domain Number 3 Region: 18-206
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000000153
Family Pyruvate oxidase and decarboxylase Pyr module 0.036
Further Details:      
 
Domain Number 4 Region: 270-350
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000606
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A0HPD7
Sequence length 1139
Comment (tr|A0A0A0HPD7|A0A0A0HPD7_9RHOB) Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunit {ECO:0000313|EMBL:KGM88444.1} KW=Complete proteome OX=1288298 OS=Roseovarius mucosus DSM 17069. GN=rosmuc_01275 OC=Rhodobacteraceae; Roseovarius.
Sequence
MTTQKVTLNDRFDLEKSPVLLNGTQALVRLMLMQAARDRAAGMNTAGYVTGYRGSPLGAV
DQQMRRAEKVLRAAQVRFEEGLNEDLAATALWGSQQAELRGEGKYDGVFGLWYGKGPGVD
RSGDVMRHANMAGTSKHGGVLMAMGDDHTGESSTVLHQSEWALVDAYMPVVSPAGVQEIL
DYGIYGYALSRFSGLWVGLKTMKDTVEATSVVDGRPDRVQLVTPDFPMPDGGLNIRLIDT
PHAQEARMIDYKRFAAEAFSRANGMDKRGLGKPGAKIGFVAAGKNWLDLVHALDLLGVDA
AEAERLGITTYKVGQVFPLDMQGFHDWAEGLELIVVVEEKRKLIEVQIKEAIFDDRRGRR
VYGWYKGGAGGMHREELFPTRGALDPIWIAEKLGAILIEEGRGTDRIKAGLDALSEARRN
DNATEITSRLPYFCSGCPHNTSTRLPEGARAYAGIGCHYMVQWMDRETTGFTHMGGEGAN
WIGEAPFSTRKHVFQNLGDGTYNHSGVQAIRAALASGTTITYKILYNDAVAMTGGQPNEG
GLNAPRIAAELRAMGVQHLAVVYDEKEDVDLKSFPQGIEFSERSELMAVQERLAKVDGVS
VILYIQTCAAEKRRRRKRGKFPDPDRRVFINTDVCEGCGDCGVQSNCVSIVPVETELGRK
RAIDQSSCNKDFSCLKGFCPSFVTLEGTKVRKDSTADLTLPDMPAPALPAIDGTYNVVIT
GVGGTGVVTIGAVMAQAAQIDGKGAGMMEMAGLAQKGGAVHIHCRLAENPDDISAIRVAT
GECDALIGGDLVVSAGAKTLGLTRQGRTGAVVNSHEIITGDFTRNTEFTLPADRLRLALE
ARLREGVQMFDASDLAKTVMGDSIYSNMMIFGAAWQRGLIPLSHEAIAEAIRLNGAAVDA
NLRAFEVGRWAALYPAEVEKLLTPKVVAKPKTLAERIAYRETHLTAYQGKRLVKRYGRML
DKITDEGVKDAVAQGYHKLLAYKDEYEVARLHLETAEKARAEFDGDFTLKFHLAPPMLSK
MGSDGRPRKREFGPGILRAFGLLARLKVLRGTPLDPFGRTAERKMERALIKDYERDMTEV
LPMLNDRTRDAIIALALLPLSIRGFGPVKEANAAKAATRRSELLAVIRSGGAEMAQAAE
Download sequence
Identical sequences A0A0A0HPD7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]