SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A0ILX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A0ILX7
Domain Number 1 Region: 101-165,225-315
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.18e-34
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 145-230
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.25e-18
Family Short-chain ferredoxins 0.052
Further Details:      
 
Domain Number 3 Region: 16-81
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.29e-17
Family Duplicated SiR/NiR-like domains 1 and 3 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A0ILX7
Sequence length 316
Comment (tr|A0A0A0ILX7|A0A0A0ILX7_CLONO) Sulfite reductase {ECO:0000313|EMBL:KGN00556.1} KW=Complete proteome OX=1444290 OS=Clostridium novyi A str. 4570. GN=Z969_09775 OC=Clostridium.
Sequence
MDINTKALMKNAYRVTKERGITALRVRVPGGHLPVKYFDIIKKIAEEYGNGDVHMTTRQG
FEIMGIDMKDIPEINKLIQPVIEGLDINQEVKDKGYSAAGTRNVAACIGNKVCKFANYNT
TKFAKRIEKAIFPNNYHVKIALTGCPNDCIKSRMHDFGIIGMTMPNYESYRCISCGACVR
TCKKKSVGALHFENFKVVRNEEKCIGCGECVIQCPTGAWTRSHEKYYKLAIMGRTGRKNP
RIAKDFIKWIDEDSIIKIILNTYDYIEEFISKDAPNGKEHIGYIVDRTGFKVFKEWALRD
VKLPEIAEVQDNIYWD
Download sequence
Identical sequences A0A0A0ILX7
WP_039250762.1.69400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]